DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and tspan1

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001016107.1 Gene:tspan1 / 548861 XenbaseID:XB-GENE-868363 Length:245 Species:Xenopus tropicalis


Alignment Length:237 Identity:67/237 - (28%)
Similarity:115/237 - (48%) Gaps:16/237 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAV------YVLLVTSII 68
            |..|:|..:.:.|..||:||..:..:.:|..||.:...::.||...|.|:      |.|:....:
 Frog     3 CFTFIKVMMILFNVFIFLGGGTLLGVGIWVSVDSNSFLKIFGTVSASAALQFVNVGYFLIAIGSL 67

  Fly    69 ICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMA-LYG 132
            :.::.||||.||.:|.||||||:|.|:.::|:..:.|.|:..|:....:..:...::..:. .||
 Frog    68 LVILGFLGCCGAQRESKCLLLTFFSIILIIFIAEVAGAVVALVYSSLAETILGPLLKPVLQNEYG 132

  Fly   133 SRREITQAWDLTQERLQCCGVDTWHDW-------NRYGPVPESCCQELFGGQRKECTIFPTITNL 190
            |..::|:.|:.|.|.|.|||.:.:.|:       |.:...|..||... ......||....: |.
 Frog   133 SNPDVTKIWNSTMENLHCCGFNNYTDFSNSTFYNNNHQQYPSYCCNST-SSANSVCTQQGAM-NS 195

  Fly   191 YNQGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLF 232
            :..||.......||.:||::||.:..:..|.:..|:.|..|:
 Frog   196 HVSGCFSQLIYLIRQNAAIVGGVAAGICALELAAMVVSMYLY 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 64/230 (28%)
tspan1NP_001016107.1 Tetraspannin 7..236 CDD:366035 64/230 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.