DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and TSPAN11

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_011518981.1 Gene:TSPAN11 / 441631 HGNCID:30795 Length:302 Species:Homo sapiens


Alignment Length:227 Identity:73/227 - (32%)
Similarity:120/227 - (52%) Gaps:23/227 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAVYVLLVTSIIICLVSFLGC 77
            ::||.||:.||..:||||.|..:.:||||::|....:|.::.|:.:.|:|:...:::.:..|||.
Human    15 YLKYLLFVFNFFFWVGGAAVLAVGIWTLVEKSGYLSVLASSTFAASAYILIFAGVLVMVTGFLGF 79

  Fly    78 VGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMA-LYG--SRREITQ 139
            .....|.|..|.|||.::.::|:..|:.|||.:|:.:|:...::|.:..|:| .||  ...:||.
Human    80 GAILWERKGCLSTYFCLLLVIFLVELVAGVLAHVYYQRLSDELKQHLNRTLAENYGQPGATQITA 144

  Fly   140 AWDLTQERLQCCGVDTWHDWNRY----------GPVPESCCQELF--GGQRKECTIFPTITNLY- 191
            :.|..|:..:|||.::..||...          ..||:|||:.:.  .|||..    |  :|:| 
Human   145 SVDRLQQDFKCCGSNSSADWQHSTYILLREAEGRQVPDSCCKTVVVRCGQRAH----P--SNIYK 203

  Fly   192 -NQGCLYVTTNFIRDHAAVIGGTSIAVAILMI 222
             ..|||.....|:.||..::|...|.||.|.|
Human   204 VEGGCLTKLEQFLADHLLLMGAVGIGVACLQI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 73/226 (32%)
TSPAN11XP_011518981.1 Tetraspannin 16..235 CDD:278750 72/224 (32%)
PHA03242 <50..>118 CDD:177566 19/67 (28%)
CD151_like_LEL 112..220 CDD:239408 32/113 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 129 1.000 Domainoid score I5261
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4638
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48589
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 1 1.000 - - FOG0002118
OrthoInspector 1 1.000 - - otm40447
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.