DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and tspan18a

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_021333136.1 Gene:tspan18a / 437007 ZFINID:ZDB-GENE-040718-232 Length:281 Species:Danio rerio


Alignment Length:252 Identity:80/252 - (31%)
Similarity:132/252 - (52%) Gaps:25/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GFSSRMDC--CGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTN--LFSGAVYVL 62
            |.|...||  |   :||.:||.||.||:||:.:..:.:|.|||.:...|::..|  ||:| ||.:
Zfish    38 GTSMEGDCLSC---IKYLMFIFNFFIFLGGSFLLGVGIWVLVDPTGFREIVAANSLLFTG-VYAI 98

  Fly    63 LVTSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERV-QQTMRQEMRS 126
            |:...::.|:.||||.||.:|.|||||.:|:::.::|:..|...:|.::|||.: :....:|:::
Zfish    99 LIMGGMLFLLGFLGCCGAIRENKCLLLFFFMLILVIFLAELAVAILAFIFREHLTRDYFTKELKT 163

  Fly   127 TMALYGSRREITQAWDLTQERLQCCGVDTWHDWN------RYGP---VPESCCQEL-FGGQRKEC 181
            ......|....|..|:.......||||::..|::      |..|   |||.|||.. ....::||
Zfish   164 HYQGTNSTDVFTSTWNAIMTTFNCCGVNSAEDFDDQSLFRRLNPSRIVPEVCCQRTDLMMSKEEC 228

  Fly   182 T--IFPTITNLYNQGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMIE 236
            .  |.|    :.|:||.....::...:..:.|..:|.|..:.:|.|:|:..||..|:
Zfish   229 LRGIMP----IRNKGCYSAVVDYFETYIYMAGALAIVVLTIELFAMVFAMCLFRGIQ 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 72/231 (31%)
tspan18aXP_021333136.1 Tetraspannin 49..278 CDD:306775 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.