DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tsp97E

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001263002.1 Gene:Tsp97E / 43241 FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster


Alignment Length:192 Identity:43/192 - (22%)
Similarity:69/192 - (35%) Gaps:66/192 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CGQFV--KYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAVYV---------LL 63
            ||.|.  |.:|...|.:..:.|.:                 |:|..:::.|..:         :|
  Fly     2 CGGFTCSKNALIALNILYVMIGFL-----------------LIGVGVYARAASIVTNLPIVGGIL 49

  Fly    64 VTSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVF-VTMLIGGVLGYVFRERVQQTMRQEMRST 127
            ...:|:..:|.||..||.|..:.:|..|.||:.::| :...|......|..|:.||         
  Fly    50 ACGVILICISMLGLAGAVKHHQVMLFFYMIILFMLFLIQFSIASSCLAVNSEQQQQ--------- 105

  Fly   128 MALYGSRREITQAWDL---TQERLQCCGVDTWHDWNRYGP-----VPES-----------CC 170
               :..:..:|...||   .|:.|:|||      :|...|     ||.|           ||
  Fly   106 ---FAEQGWMTVPTDLRKQVQDSLKCCG------FNATAPSTTSVVPPSNEPSCELINQQCC 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 40/188 (21%)
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 40/187 (21%)
tetraspanin_LEL <121..177 CDD:243179 12/44 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.