DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tsp96F

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster


Alignment Length:271 Identity:70/271 - (25%)
Similarity:122/271 - (45%) Gaps:54/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGFSSRMDCCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELL-GTNLFSGAVYVLLV 64
            ||.:.   || ..|||.:.:.|.:.::.|..:...::|.|.|.:|:..:. ..|.:..|:||.|.
  Fly     1 MGLNG---CC-SCVKYLMVLINILFWLIGLTIVVTSVWMLTDPTFMLSMTQNYNHYHIALYVFLA 61

  Fly    65 TSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTM- 128
            ..|:|.|.:|.||.|..:|.:|||:::|.::.:|.|..:..|...:..::::...:|..::|:: 
  Fly    62 IGILITLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQ 126

  Fly   129 ALYG----SRREITQAWDLTQERLQCCGVDTWHDW---------------------NRYGPVPES 168
            ..||    |.|.:|  :|..|:.|:|||.|...||                     |.:..:|||
  Fly   127 EEYGQSTMSSRTVT--FDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPES 189

  Fly   169 CCQE-------------LFGGQRKECTIFPTITNLYNQGCLYVTTNFIRDHAAVIGGTSIAVAIL 220
            ||::             .|||        |....:|.|||:......|.::...|...:.||.:|
  Fly   190 CCKDNLKDNECELSRRLKFGG--------PLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILL 246

  Fly   221 MIFGMIFSCLL 231
            .:..:.|:..|
  Fly   247 ELLSLTFALSL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 65/256 (25%)
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 66/259 (25%)
CD151_like_LEL 107..233 CDD:239408 31/135 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.