DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and zgc:64051

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_956665.1 Gene:zgc:64051 / 393342 ZFINID:ZDB-GENE-040426-1349 Length:221 Species:Danio rerio


Alignment Length:233 Identity:65/233 - (27%)
Similarity:112/233 - (48%) Gaps:35/233 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CGQFVKYSLFIANFVIFVGGAIVFCLTLW--TLVDRSFVNELLGTNLFSGAVYVLLVTSIIICLV 72
            |.:.:||.:.:.||:.|:.||.:|.:.::  |....|.:..|...::.:    .|.:|.|||..|
Zfish     3 CLKCLKYIMCVVNFIFFICGAAIFGMGIYLMTFSRLSLLPSLQAMSIAN----TLFITGIIITCV 63

  Fly    73 SFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGSRREI 137
            ||||.:||.||.:|||:::||::.::.:..|....|..::..:::..::.::     :.|..:.|
Zfish    64 SFLGFLGALKENRCLLISFFILLFILMLAELAAACLMLMYESKIENFIKDDL-----VDGLNQSI 123

  Fly   138 --------TQAWDLTQERLQCCGVDTWHDWNRYGPVPESCCQELFGGQRKECTIFPTITNLYNQG 194
                    |..||..||...|||:....||.  |.||:||  .:.|            |:.:::|
Zfish   124 KNRKQHNTTDDWDKVQETFGCCGIQNATDWQ--GFVPQSC--NISG------------TSNWHKG 172

  Fly   195 CLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLF 232
            |..:..|....:....|...|.|.|:.:.||.||..||
Zfish   173 CFKLLENSFESNLLSTGIGVIVVCIIEVLGMCFSMTLF 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 62/226 (27%)
zgc:64051NP_956665.1 Tetraspannin 6..213 CDD:278750 64/230 (28%)
CD53_like_LEL 101..189 CDD:239417 22/108 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.