DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tsp66E

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_523985.1 Gene:Tsp66E / 39017 FlyBaseID:FBgn0035936 Length:267 Species:Drosophila melanogaster


Alignment Length:259 Identity:76/259 - (29%)
Similarity:124/259 - (47%) Gaps:37/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DCCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELL------------GTNLFSGAVY 60
            ||.....||.|.|.||:.||.|.|:|.:.||..||:..:..||            .........|
  Fly     4 DCGVWCAKYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVESERIEQFTQPQAIEQLAY 68

  Fly    61 VLLVTSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMR 125
            ||||...::..:||||.:||.:|.:|||.||...:.|:.:..::.|.||..|:::|:...:..::
  Fly    69 VLLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAESKNFLQ 133

  Fly   126 STMALY--GSRREITQ-AWDLTQERLQCCGVDTWHD------W-----NRYGPVPESCC-----Q 171
            :|:..|  |...:.|. .|:.......|||::.:||      |     ||  .:|::||     .
  Fly   134 TTITSYSLGENVDATSLMWNQLMGNFGCCGINDYHDFDASPAWVNGKGNR--TIPDACCILKDVA 196

  Fly   172 ELFGGQRKECTIFPTITN-LYNQGCLYVTTNF-IRDHAAVIGGTSIAVAILMIFGMIFS-CLLF 232
            :|. .:.::||..|:.:| .|.:||..|.|.: ||....||...::.:..|::..:.|: |..|
  Fly   197 KLV-PRDEDCTTNPSDSNSFYKKGCYEVFTEWLIRQRELVIVAIAVGIVHLVLIILAFALCKAF 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 73/250 (29%)
Tsp66ENP_523985.1 Tetraspannin 9..258 CDD:278750 73/251 (29%)
uroplakin_I_like_LEL 116..231 CDD:239409 31/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.