DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and TM4SF

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001261159.1 Gene:TM4SF / 37786 FlyBaseID:FBgn0020372 Length:292 Species:Drosophila melanogaster


Alignment Length:242 Identity:62/242 - (25%)
Similarity:102/242 - (42%) Gaps:65/242 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSG-AVYVLLV-------TS 66
            |.:::.||..:  .:...|.|.:|                |||:|..| :||..:|       .:
  Fly     9 CFKYLVYSYVV--LLALTGAAQIF----------------LGTSLLWGHSVYYGIVQNKLWAPAA 55

  Fly    67 IIICL--VSF----LGCVGAGKEVKCLL-LTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEM 124
            |::||  |:|    :||....:..:||| :...::||.:.|..:|.|         ....||:.:
  Fly    56 ILLCLGPVTFILCWMGCQATNQRKRCLLGMFAALLVACICVQFIICG---------WSLAMRENL 111

  Fly   125 RSTMALY-----------GSRREI--TQAWDLTQERLQCCGVDTWHDWNRYGPVPESCCQELFGG 176
            .:::.::           .||.::  ...|:..|.:|||||||...|:.|.. :|.|||      
  Fly   112 PTSVEIFIDDSFVEFLDKFSRTKVDNLHLWNRMQSQLQCCGVDGPLDYRRLS-LPWSCC------ 169

  Fly   177 QRKECTIFPTITNLYNQGCLYVTTNFIRDHAAVIGGTSIAVAILMIF 223
            .|.|..........|.:|||.|.:..||:...:   |:...||:.||
  Fly   170 SRPEHAYESACDTHYKRGCLAVVSEQIRNRLLI---TAFGAAIIAIF 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 61/238 (26%)
TM4SFNP_001261159.1 Tetraspannin 9..224 CDD:278750 62/242 (26%)
uroplakin_I_like_LEL 111..197 CDD:239409 24/92 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.