DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tsp47F

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster


Alignment Length:247 Identity:77/247 - (31%)
Similarity:122/247 - (49%) Gaps:32/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MDCCG-QFVKYSLFIANFV-------IFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAV---- 59
            |..|| ..:||.||..|.:       |.:.||:|       |.|   |||.  .:...|.|    
  Fly     1 MRSCGPSLIKYVLFAFNVLFAISGLGILIAGAVV-------LAD---VNEF--NHFVEGRVLAPP 53

  Fly    60 YVLLVTSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEM 124
            .||:||.:||.|::.|||.||.||...||:|:.:::|::|:..|..|:...||::.::..::..:
  Fly    54 IVLIVTGLIIFLIASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSL 118

  Fly   125 RSTMALYGSRREITQAWDLTQERLQCCGVDTWHDWNRYG---PVPESCCQ-ELFGGQRKECTIFP 185
            :.  ::..|..|.|.|||..|::|.|||||:..||....   .:|.|||| :........|...|
  Fly   119 QE--SIKRSNSEDTMAWDNIQQKLMCCGVDSPADWRTLSANKTLPGSCCQPQYIDSTVGHCLESP 181

  Fly   186 TI--TNLYNQGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMI 235
            .:  ...:..||:....:.|..:|.::.|..|.:|.:.|.|::.:|.|.|.|
  Fly   182 ALGKDKYFQVGCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 71/233 (30%)
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 73/237 (31%)
uroplakin_I_like_LEL 102..205 CDD:239409 27/104 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138800at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40247
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.