DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tsp42Eo

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_523641.2 Gene:Tsp42Eo / 35625 FlyBaseID:FBgn0033136 Length:219 Species:Drosophila melanogaster


Alignment Length:240 Identity:49/240 - (20%)
Similarity:83/240 - (34%) Gaps:74/240 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 CLTLWTLVDRSFVNELLGTNLFSGAVY----------------VLLVTSIIICLVSFLGCVGA-- 80
            ||. ||.|..|.:..::|.......||                |.|..:..:.|...:||:||  
  Fly     7 CLQ-WTSVVFSTLTLIVGVLAALAGVYELDKFNEGSAEHTEKFVQLGMAGALILAGLVGCLGAIF 70

  Fly    81 GKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGSRREITQAW---- 141
            | .:|.:::...:::||         :..::::.       .....|..|..:...:...|    
  Fly    71 G-SIKVMVVNLILLLAL---------IASHIWKV-------SHYNETKQLDATEVYVMDLWMKEL 118

  Fly   142 -------DLTQERLQCCGVDTWHDWNRYG-PVPESCCQELFGGQRKECTIFPTITNLYNQGC--- 195
                   ||.|| .:|||...:.|:.... .||.||.....|..    .::|     |.:||   
  Fly   119 VHHGAMQDLQQE-YECCGDKGFSDYTSLNMKVPRSCFHTKDGIH----ALYP-----YGEGCMAA 173

  Fly   196 -------LYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFN 233
                   :|....::  |..:||...:.:    |.|:...|.|.|
  Fly   174 VKRAYLQIYRYEKWV--HCGLIGYEVVGI----ILGITLCCQLTN 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 47/236 (20%)
Tsp42EoNP_523641.2 Tetraspannin 7..210 CDD:278750 47/236 (20%)
tetraspanin_LEL 110..178 CDD:239401 18/77 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.