DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tsp42Ek

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001246161.1 Gene:Tsp42Ek / 35621 FlyBaseID:FBgn0033133 Length:215 Species:Drosophila melanogaster


Alignment Length:218 Identity:49/218 - (22%)
Similarity:84/218 - (38%) Gaps:58/218 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RSFVNELLGTNLFSG---------------AVYVLLVTSI--IICLVSFLGCVGAGKEVKCLLLT 90
            :.|:|.|...|..||               ..|:|.:..:  ||.:.:.|||.|...|..|:..|
  Fly     9 KCFLNTLNTLNALSGLSLIAIATLALSKAPIAYILFLYGLGGIIFVSAVLGCCGICMENVCMTAT 73

  Fly    91 Y-FIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGSRREITQAW----------DLT 144
            | |:::|.:.:::|  |:..:.|.|...:....|            |:...|          |:.
  Fly    74 YGFLLLAQLIISLL--GIFRFKFTEEYIEKFAAE------------EVQMKWDEELVEPGAMDIY 124

  Fly   145 QERLQCCGVDTWHDWNRYG--PVPESCCQELFGGQRKECTIFPTITNLYNQGCLYVTT-NFI--R 204
            |...:|||.|:..|:...|  .:|.||..:       |....|.    |..||:..:: ||:  .
  Fly   125 QTVYECCGRDSPDDYVAIGRQTLPPSCYPQ-------EDPQMPH----YLAGCVQKSSENFVVLF 178

  Fly   205 DHAAVIGGTSIAVAILMIFGMIF 227
            .:|......::.:.|||:....:
  Fly   179 SYAHDTNWIALGITILMMIAAFY 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 49/218 (22%)
Tsp42EkNP_001246161.1 Tetraspannin 7..202 CDD:278750 49/218 (22%)
tetraspanin_LEL 94..174 CDD:239401 21/102 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.