DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tsp42Ej

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster


Alignment Length:219 Identity:47/219 - (21%)
Similarity:82/219 - (37%) Gaps:36/219 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAVYVLLVTSIIICLVSFLGCVG 79
            ||.|.:...:|.......|...:.|......|....|:.|..|||:.          |:|||...
  Fly    11 KYGLLVTCILIVTCNVFFFSCGVTTWGSAVSVYGSYGSALCGGAVFG----------VAFLGMYV 65

  Fly    80 AGKEVKCLLLTY-FIIVALVFVTMLIGGVLGYVF-----RERVQQTMRQEMRSTMALYGSRREIT 138
            |      |.::| :.|..|:...::|..:..|:|     ||::.....:.||.   |:..:....
  Fly    66 A------LKVSYKYSIYYLICSGLVIAALGSYLFTFTAMREQLMGRFEERMRD---LFERKTHSD 121

  Fly   139 QAWDLTQERLQCCGVDTWHDW--NRYGPVPESCCQELFGGQRKECTIFPTITNLYNQGCLYVTTN 201
            ...........|||::...|:  ..:|.:|.|||...      :|:   ...::|.:||......
  Fly   122 DKMQPVHSLFGCCGIEGPQDYLQEEHGALPSSCCYAF------DCS---KPAHVYEEGCSTKAVA 177

  Fly   202 FIRDHAAVIGGTSIAVAILMIFGM 225
            .:|..|.:...:.:|:..|...|:
  Fly   178 TLRMQAELNYYSCMAIIALEFLGL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 47/219 (21%)
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 47/219 (21%)
tetraspanin_LEL 97..183 CDD:239401 19/97 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.