DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tsp42Ei

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001260756.1 Gene:Tsp42Ei / 35618 FlyBaseID:FBgn0033130 Length:229 Species:Drosophila melanogaster


Alignment Length:228 Identity:55/228 - (24%)
Similarity:102/228 - (44%) Gaps:22/228 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAVYVLLVTSIIICLVSFLGCV 78
            ||:.|.:.|||..|.|..:....::.|:..:.....:|.|:..|.:..|   .::|.:::..||:
  Fly     8 VKHVLLLLNFVFSVLGLALIAFGIFFLISAAENAVSIGKNVAGGLIIAL---GVVILIIAIFGCL 69

  Fly    79 GAGKEVKCLLLTYF-IIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGSRREITQAWD 142
            .|..|....||.|. .:|.|:...::..|:..:..::.:..::.:...   .|:.|.|..|.|..
  Fly    70 AAIHEAPVRLLIYVGAVVLLILAQLIFLGMSSHGTKDGISGSINEGFD---RLWESERNQTGALS 131

  Fly   143 LTQERLQCCGVDTWHD-WNRYGPVPESCCQELFGGQRKECTIFPTITNLYNQGCLYVTTNFIRDH 206
            ..:..||||||::..| |..:..:|.|||.|      .:|  ..|.:.::..||......::.|.
  Fly   132 YYESWLQCCGVNSSEDYWIIHHGIPSSCCPE------SKC--MDTPSRVFKTGCKAAFVKYLDDK 188

  Fly   207 AAVIGGTSIAVAILMI---FGMIFSCLLFNMIE 236
            ..|.   .|...:|:|   .|.:|..||::.::
  Fly   189 LLVF---KIVCWLLVIGEAVGAVFGWLLYSSVK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 53/221 (24%)
Tsp42EiNP_001260756.1 Tetraspannin 7..217 CDD:278750 55/225 (24%)
DUF373 <17..>101 CDD:299895 20/86 (23%)
tetraspanin_LEL 104..189 CDD:239401 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.