DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tsp42Ee

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001260753.1 Gene:Tsp42Ee / 35614 FlyBaseID:FBgn0029506 Length:228 Species:Drosophila melanogaster


Alignment Length:254 Identity:74/254 - (29%)
Similarity:107/254 - (42%) Gaps:60/254 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MDCCGQFVKYSLFIANFVIFVGG--AIVFCLTLWTLVDRSFVNELLGTNLFSGAVYVLLVTSIII 69
            |||....|||.|||.|.::.|.|  .||:.:.:...:....||..:|..:.:....:|:....|:
  Fly     1 MDCGTSMVKYILFIFNTIVSVIGILGIVYGVLILKSIGVVEVNGQVGFPIQALMPIILISLGSIV 65

  Fly    70 CLVSFLGCVGAGKEVKCLLLTY------FIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTM 128
            ..:|||||.||.:|..|:.::|      .:|:.|.||.:|.              |.|:|..:.|
  Fly    66 VFISFLGCCGAIRESVCMTMSYATFLLILLILQLTFVVLLF--------------THREEFENAM 116

  Fly   129 ALYGSRREITQAW-----------DLTQERLQCCGVDTWHDWNRYGP-VPESCCQELFGGQRKEC 181
            .     ..|..||           |..|:.|.|||..:..|:...|. ||.|||.       ..|
  Fly   117 G-----NVIENAWNSEHTYKGGVFDTIQKSLHCCGSSSALDYIGKGDLVPPSCCS-------GSC 169

  Fly   182 TIFPTITNLYNQGCL-----YVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMI 235
            .| |  ||.| .||.     .:||.  .|:|..:|   |.:..:.:.|.||:|.|.|.:
  Fly   170 LI-P--TNYY-PGCRGKFVELMTTG--SDNAKYVG---IGLIGIELIGFIFACCLANNV 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 69/241 (29%)
Tsp42EeNP_001260753.1 Tetraspannin 8..219 CDD:278750 71/245 (29%)
tetraspanin_LEL 106..187 CDD:239401 28/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.