DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tsp42Ed

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster


Alignment Length:231 Identity:63/231 - (27%)
Similarity:111/231 - (48%) Gaps:19/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MDCCGQFVKYSLFIANFVIFVGGAIVF---CLTLWTLVDRSFVNELLGTNLFSGAVYVLLVTSII 68
            |||.|.||||.|||.|.:..:.|.::.   .:.:.|:.|.|.|.|....|   ....::||...:
  Fly     1 MDCGGVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTAN---SVAIIILVLGCV 62

  Fly    69 ICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGS 133
            :.||:|:||.||.:|..|.|.:|.:::.::.|:.|...:..:|...::||::.:.:::   ::..
  Fly    63 VFLVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIVQT---IWDQ 124

  Fly   134 RREITQAWDLTQERLQCCGVDTWHDWNRYG-PVPESCCQELFGGQRKECTIFPTITNLYNQGCLY 197
            |:......|..|...:|||::.:.|   || ..|.|||.....|   .|.:...:|   ...||.
  Fly   125 RKTDALLMDTLQRSFKCCGLNGFAD---YGITYPASCCDSPSNG---TCALTQVMT---RSSCLK 180

  Fly   198 VTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFN 233
            ...:|...:.::|....:.|..:.:...||:|.|.|
  Fly   181 AVDSFWDTNVSIIKYAGLGVTAVELVAFIFACCLAN 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 56/220 (25%)
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 58/224 (26%)
tetraspanin_LEL 104..189 CDD:239401 22/96 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.