DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tsp39D

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster


Alignment Length:232 Identity:59/232 - (25%)
Similarity:113/232 - (48%) Gaps:12/232 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSRMDCCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAVYVLLVTSII 68
            |..:.|    |||..|..|.:..:.|.::|.:.....::.:..:..:..::::..: :|::....
  Fly     3 SGGLTC----VKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPI-ILMIVGAA 62

  Fly    69 ICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGS 133
            :.::.||||.||.||..|::|::.::..::|:..:..|:.|||....:.|.|..:..|||..|..
  Fly    63 VAVICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKE 127

  Fly   134 RREITQAWDLTQERLQCCGVDTWHDWN---RYGPVPESCCQELFGGQRKECTIFPTITNLYNQGC 195
            |.:...||.|.|..|.|||::..:||.   |...:|.:||..:...:.|||    |.|:....||
  Fly   128 RADYRDAWTLLQTELDCCGINGPNDWETVYRNSTLPAACCSVINLSEAKEC----TNTHATQHGC 188

  Fly   196 LYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLF 232
            |......:.....::....:.||.:.:..::|:|.|:
  Fly   189 LQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLY 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 56/219 (26%)
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 58/227 (26%)
tetraspanin_LEL 104..200 CDD:239401 31/99 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130922at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40247
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.