DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tsp33B

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_523552.1 Gene:Tsp33B / 34590 FlyBaseID:FBgn0032376 Length:326 Species:Drosophila melanogaster


Alignment Length:228 Identity:45/228 - (19%)
Similarity:84/228 - (36%) Gaps:60/228 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LLGTNLFSGAVYVLLVTSIIICLVSFLGCVGAGKEV---KC-----LLLTYFIIVALVFVTMLIG 105
            |.|..:|...|           :|:||..:...:.:   :|     |||:.:...:.|.:....|
  Fly    53 LFGIYVFGAQV-----------VVTFLCSIAMWRRIWRRRCTPNIRLLLSVWAFYSCVIIASGFG 106

  Fly   106 GVLGYVFR--ERVQQTMRQEMRSTMALYGSRREITQAWDLTQERLQCCGVDTWHDW--NRYGP-- 164
            .|.. ::|  :.::......:...:.:|.|..|....||..|...:||||..:.||  ..:.|  
  Fly   107 CVWN-LYRGVDVLENAADTSLTRGIDMYYSCPEWKLLWDGLQWHKECCGVHGYKDWMNAEWMPRR 170

  Fly   165 ---------VPESCC----------------QELFGGQRKECTIFP--TITNLYNQGCLYVTTNF 202
                     .|.:||                |.:.|..|:.   ||  |:.::...|||....:.
  Fly   171 ENNCTSMVLAPFACCKRSCDSCFNNFLPSEGQSIGGNSRQP---FPALTVDSINANGCLPAFVSA 232

  Fly   203 IRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMI 235
            :.:...::    :|:.:|.:..:|..|.:...|
  Fly   233 VWNCFYIL----MALWVLALKFLIVLCCMTKFI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 44/222 (20%)
Tsp33BNP_523552.1 Tetraspannin 20..256 CDD:278750 43/221 (19%)
CD151_like_LEL 112..237 CDD:239408 26/127 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.