DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tsp29Fb

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001137809.1 Gene:Tsp29Fb / 34212 FlyBaseID:FBgn0032075 Length:308 Species:Drosophila melanogaster


Alignment Length:265 Identity:66/265 - (24%)
Similarity:106/265 - (40%) Gaps:68/265 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSRMDCCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNL-------------- 54
            :|.|.|    .||.|.|.:|        :|.||...|:       ::||.:              
  Fly     9 NSGMKC----AKYMLIIVSF--------MFALTAILLI-------MVGTTIQTIFGDFSLFIDGH 54

  Fly    55 FSGAVYVLLVTSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQT 119
            ||....:|:....|:..|:.||..||.||...::..|.:.:.|||:..:...:..:|.:.:|:..
  Fly    55 FSSPPALLIAIGFILIAVAALGAYGAVKESVMVINLYGVCLFLVFILEVSAAIAAFVMQSQVRGM 119

  Fly   120 MRQEMRSTMALYGSRREITQAWDLTQERLQCCGVDTWHDWNRY-------------GPVPESCCQ 171
            :.:.|...:|.|.....:....|..|..|:||||:...||..|             ..||.||| 
  Fly   120 LIRTMNQALAEYEHDPYVESGVDFMQSMLECCGVNEPEDWKDYLSANVNFTLGVDDVVVPNSCC- 183

  Fly   172 ELFGGQRKECTIFPTITN---------LYNQGCLYVTTNFIRDHAAVIGGT-SIAVAILMIFGMI 226
               |.|       ||..|         .|:.|| :...|||...:|::..| :..||.:.:.|::
  Fly   184 ---GNQ-------PTSLNDSTQMTCMETYDYGC-FRKMNFIVSQSAMLIATGATTVAFVQLLGVL 237

  Fly   227 FSCLL 231
            .:.:|
  Fly   238 CAFML 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 62/253 (25%)
Tsp29FbNP_001137809.1 Tetraspannin 14..246 CDD:278750 64/260 (25%)
tetraspanin_LEL 110..218 CDD:239401 31/119 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130922at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.