DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tspan11

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001019433.1 Gene:Tspan11 / 312727 RGDID:1305424 Length:253 Species:Rattus norvegicus


Alignment Length:240 Identity:78/240 - (32%)
Similarity:125/240 - (52%) Gaps:23/240 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAVYVLLVTSIIICLVSFLGCV 78
            :||.|||.||..:||||.|..:.:||||::|....:|.::.|:.:.|||:....::....|||..
  Rat    16 LKYLLFIFNFFFWVGGAAVMAVGIWTLVEKSVYLSILASSTFAASAYVLIFVGGLVMTTGFLGFG 80

  Fly    79 GAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMA-LYG--SRREITQA 140
            ...:|.|..|.|||.::..:|:..|:.|||.:|:.:|:...:::.:.||:. .||  ...|||.:
  Rat    81 AIIREQKSCLSTYFCLLLAIFLVELVAGVLAHVYYQRLSDELKRHLHSTLTEHYGQPGAAEITAS 145

  Fly   141 WDLTQERLQCCGVDTWHDWNRY----------GPVPESCCQELFG--GQRKECTIFPTITNLY-- 191
            .|..|:..:|||.::..||...          ..||:|||:.:..  |||..    |  :|:|  
  Rat   146 VDRLQQDFKCCGSNSSADWQHSVYILSQEAIGRQVPDSCCKTVVARCGQRAH----P--SNIYKV 204

  Fly   192 NQGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMIE 236
            ..||:.....|:.||..::|...|.||.|.|.||:.:|.|...::
  Rat   205 EGGCMAKLEQFLADHLLLMGAVGIGVACLQICGMVLTCCLHRRLQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 77/233 (33%)
Tspan11NP_001019433.1 Tetraspannin 16..248 CDD:278750 78/237 (33%)
CD151_like_LEL 112..220 CDD:239408 31/113 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I5035
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I4487
OMA 1 1.010 - - QHG48589
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 1 1.000 - - FOG0002118
OrthoInspector 1 1.000 - - otm44589
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.