DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tsp3A

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster


Alignment Length:262 Identity:61/262 - (23%)
Similarity:112/262 - (42%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QFVKYSLFIANFVIFVGGAIVFCLTLWTLVDR-----------SFVNELLGTNLFSGAVYVLLVT 65
            |.|||.:|:.|||.::.|.::..:.::...|:           :|.:..|..:|      |:::.
  Fly    41 QCVKYMIFLLNFVFWLFGGLLLGIGVYAFRDKWEDANGSVRLENFYDVFLNISL------VMILA 99

  Fly    66 SIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTM-RQEMRSTMA 129
            ..:|.||||.|||||.:|...||..|.:.:.|.|:..:...::.:|..:.:...: :|.....:.
  Fly   100 GTVIFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTHKIIH 164

  Fly   130 LYGSRREITQAWDLTQERLQCCGVDT--WHDW--NRY----GP------VPESCC---------- 170
            .|....::....|..|:..:|||:..  :.||  |.|    .|      ||.|||          
  Fly   165 SYRDDPDLQNFIDFAQQEFKCCGLSNSGYQDWSKNEYFNCSSPSVEKCGVPYSCCINATDISSGL 229

  Fly   171 QELFGGQRKECTIFPTITNL-YNQGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNM 234
            ..:..|...:....|..|.| :..||:.:...:...:..||.|.::.:|::.:..:..:..|...
  Fly   230 VNIMCGYGVQNAPVPEATKLIWTSGCIEIVRVWAEHNLYVIAGNALGIALIQLLVIYLAKTLEGQ 294

  Fly   235 IE 236
            ||
  Fly   295 IE 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 57/253 (23%)
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 58/258 (22%)
penumbra_like_LEL 144..267 CDD:239411 24/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.