DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tsp2A

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001188523.1 Gene:Tsp2A / 31080 FlyBaseID:FBgn0024361 Length:244 Species:Drosophila melanogaster


Alignment Length:219 Identity:58/219 - (26%)
Similarity:95/219 - (43%) Gaps:26/219 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVN--ELLGTNLFSGAVYVLLVTSIIICLVSFLG 76
            |||:||..|.|.::....:|.||:|...:..|.:  .:|....|...||||:..||::..|||||
  Fly    19 VKYTLFCFNIVAWMISTALFALTVWLRAEPGFNDWLRILEAQSFYIGVYVLIGISIVMMAVSFLG 83

  Fly    77 CVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGSRREITQA- 140
            |:.|..|....|..:.......|:.::.|..:...| ..:..:::..:..::..:.:..|.|.: 
  Fly    84 CLSALMENTLALFVFVGTQVFGFIAIVAGSAVLLQF-STINSSLQPLLNVSLRGFVATSEYTYSN 147

  Fly   141 WDLT--QERLQCCG-VDTWHDWNRYGPVPESCCQELFGGQRKECTIFPTITNLYNQGCLYVTTNF 202
            :.||  ||.:.||| ...|...:...|:|.||...:.|             |.:..||:...|.|
  Fly   148 YVLTMIQENIGCCGATGPWDYLDLRQPLPSSCRDTVSG-------------NAFFNGCVDELTWF 199

  Fly   203 IRDHAAVIGGTSIAVAILMIFGMI 226
            ..      |.|...||:.|..|::
  Fly   200 FE------GKTGWIVALAMTLGLL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 58/219 (26%)
Tsp2ANP_001188523.1 Tetraspannin 18..232 CDD:278750 58/219 (26%)
tetraspanin_LEL 116..204 CDD:239401 22/107 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.