DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Upk1b

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001019424.1 Gene:Upk1b / 303924 RGDID:1307806 Length:260 Species:Rattus norvegicus


Alignment Length:244 Identity:55/244 - (22%)
Similarity:96/244 - (39%) Gaps:39/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LFIANFVIFVGGAIVFCLTLWTLVDRSFVNELL-GTN---LFSGAVYVLLVTSIIICLVSFLGCV 78
            |...:.::.:.|..:....::.:.|:..:..|| .||   :| ||.::.:...|.:..:|.|..|
  Rat    15 LIFGHVIVGMCGIALTAECIFFVSDQHSLYPLLEATNNDDIF-GAAWIGMFVGICLFCLSVLAIV 78

  Fly    79 GAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRE-------RVQQTMRQEMRS--TMALYGSR 134
            |..|..:.:||.|||::.:|:...:...:.....|:       ..|..||.:..|  |.......
  Rat    79 GIMKSNRKILLAYFIMMFIVYGFEVASCITAATQRDFFTTNLFLKQMLMRYQNNSPPTNDDKWKN 143

  Fly   135 REITQAWDLTQERLQCCGVDTWHDWNRYG------------PVPESCC-----QELFGGQRKECT 182
            ..:|:.||....:..||||:...||.:|.            |.|..||     ||..  ....|.
  Rat   144 SYVTKTWDRLMLQDHCCGVNGPSDWQKYTSAFRVENSDADYPWPRQCCVMDKLQEPL--NLDACK 206

  Fly   183 IFPTITNLY-NQGCLYVTTNFIRDHA---AVIGGTSIAVAILMIFGMIF 227
            :  .:...| :|||..:.:..:..||   |..|...:.....::.|.:|
  Rat   207 L--GVPGYYHSQGCYELISGPMDRHAWGVAWFGFAILCWTFWVLLGTMF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 55/244 (23%)
Upk1bNP_001019424.1 Tetraspannin 10..258 CDD:278750 55/244 (23%)
uroplakin_I_like_LEL 120..230 CDD:239409 26/113 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.