DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Cd63

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_008763246.1 Gene:Cd63 / 29186 RGDID:62080 Length:262 Species:Rattus norvegicus


Alignment Length:234 Identity:64/234 - (27%)
Similarity:114/234 - (48%) Gaps:19/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAVYVLLVTSIIICLVSF 74
            |.:|:.|.|.:| |.....|.|...:.:..::.::..:|....:|..   .|::.....:.||:|
  Rat    33 CVKFLLYVLLLA-FCACAVGLIAIGVAVQVVLKQAITHETTAGSLLP---VVIIAVGAFLFLVAF 93

  Fly    75 LGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGSRREITQ 139
            :||.||.||..||::|:.|.::|:.:..:...:.|||||::|:....:..:..|..|.:..:...
  Rat    94 VGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFSKSFQKQMQNYLTDNKTAT 158

  Fly   140 AWDLTQERLQCCGVDTWHDWNRY-----GPVPESCCQEL---FGGQRKECTIFPTITNLYNQGCL 196
            ..|..|:..:|||...:.||.|.     ..||:|||..:   .|...||.||       :.|||:
  Rat   159 ILDKLQKENKCCGASNYTDWERIPGMAKDRVPDSCCINITVGCGNDFKESTI-------HTQGCV 216

  Fly   197 YVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMI 235
            .....::|.:..::.|.::.:|.:.:.|:||||.|...|
  Rat   217 ETIAAWLRKNVLLVAGAALGIAFVEVLGIIFSCCLVKSI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 60/224 (27%)
Cd63XP_008763246.1 Tetraspannin 33..255 CDD:278750 63/232 (27%)
ATP-synt_A <72..131 CDD:294288 18/61 (30%)
CD63_LEL 129..227 CDD:239419 29/104 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.