DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Upk1b

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_849255.2 Gene:Upk1b / 22268 MGIID:98912 Length:260 Species:Mus musculus


Alignment Length:245 Identity:55/245 - (22%)
Similarity:97/245 - (39%) Gaps:41/245 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LFIANFVIFVGGAIVFCLTLWTLVDRSFVNELL-GTN---LFSGAVYVLLVTSIIICLVSFLGCV 78
            |...:.::.:.|..:....::.:.|:..:..|| .||   :| ||.::.:...|.:..:|.|..|
Mouse    15 LIFGHVIVGMCGIALTAECIFFVSDQHSLYPLLEATNNDDIF-GAAWIGMFVGICLFCLSVLAIV 78

  Fly    79 GAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRE-------RVQQTMRQEMRS--TMALYGSR 134
            |..|..:.:||.|||::.:|:...:...:.....|:       ..|..||.:..|  |.......
Mouse    79 GIMKSNRKILLAYFIMMFIVYGFEVASCITAATQRDFFTTNLFLKQMLMRYQNNSPPTNDDEWKN 143

  Fly   135 REITQAWDLTQERLQCCGVDTWHDWNRYG------------PVPESCCQELFGGQRKE------C 181
            ..:|:.||....:..||||:...||.:|.            |.|..||   ...:.||      |
Mouse   144 NGVTKTWDRLMLQDHCCGVNGPSDWQKYTSAFRVENNDADYPWPRQCC---VMDKLKEPLNLDAC 205

  Fly   182 TIFPTITNLY-NQGCLYVTTNFIRDHA---AVIGGTSIAVAILMIFGMIF 227
            .:  .:...| :|||..:.:..:..||   |..|...:.....::.|.:|
Mouse   206 KL--GVPGYYHSQGCYELISGPMDRHAWGVAWFGFAILCWTFWVLLGTMF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 55/245 (22%)
Upk1bNP_849255.2 uroplakin_I_like_LEL 120..230 CDD:239409 26/114 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.