DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and tsp-16

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_509183.2 Gene:tsp-16 / 192066 WormBaseID:WBGene00006642 Length:311 Species:Caenorhabditis elegans


Alignment Length:220 Identity:49/220 - (22%)
Similarity:88/220 - (40%) Gaps:38/220 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GQFVKYSL-FIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAVYVLL---VTSIIICL 71
            ||.:|..| .:.:.:..:|...:....:.||.:.||...::||||.....|:|:   :.|.::..
 Worm    14 GQCLKKCLALLLSVLTMIGSGFIVGFGIQTLREVSFTASVIGTNLIVYCPYLLILVGILSFVMTP 78

  Fly    72 VSFLGCVGAGKEVKCLLLTYFIIVALVFVTM-LIGGVLGYVFRERVQQT-MRQEMR-STMALYG- 132
            |.|...:....::   ::|: :...:.|.|: .:..:|||.....|..: |...|: |....|| 
 Worm    79 VRFFSIILNDNKI---MITH-MFATIFFATICAMTAILGYDLNSHVSSSDMEHWMKHSIKEDYGN 139

  Fly   133 -SRREITQAWDLTQERLQCCGV--------DTWHDWNRYGP---VPESCCQELFGGQRKECTIF- 184
             :...|.:.|:....:.:||||        ..|:...:..|   :|:|||........:.|..| 
 Worm   140 PTAPHIMEEWNKAHRQFKCCGVRNLTDFVESKWYIMQKKHPRQRIPDSCCASCATMHERFCVAFF 204

  Fly   185 -------------PTITNLYNQGCL 196
                         .||....:.|||
 Worm   205 KEPGNQPHQLVKNQTICLQASNGCL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 47/217 (22%)
tsp-16NP_509183.2 Tetraspannin 26..>189 CDD:278750 36/166 (22%)
uroplakin_I_like_LEL 118..210 CDD:239409 20/91 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.