DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tspan8

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_598210.1 Gene:Tspan8 / 171048 RGDID:621783 Length:235 Species:Rattus norvegicus


Alignment Length:238 Identity:65/238 - (27%)
Similarity:116/238 - (48%) Gaps:29/238 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELL-----GTNLFSGAVYVLLVTSIIICLVS 73
            :|||:|..||:.:|.|.::..|.:|..|.:. ..|::     |||.|. ||.:|:....||.::.
  Rat     8 LKYSMFFFNFLFWVCGTLILGLAIWLRVSKD-GKEIITSGDNGTNPFI-AVNILIAVGSIIMVLG 70

  Fly    74 FLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRER----VQQTMRQEMRSTMALYGSR 134
            ||||.||.||.:|:||.:||.:.|:.:..:..|:||..|:..    :.:|:.:..:.........
  Rat    71 FLGCCGAVKESRCMLLLFFIGLLLILLLQVAAGILGATFKSESSRILNETLYENAKLLSETSNEA 135

  Fly   135 REITQAWDLTQERLQCCGVDTW-HDWNRYGPVPESCCQ------ELFGGQRKECTIFPTITNLYN 192
            :|:.:|....|...:|||:... .||.:..|..:..||      |.:.|:           |:|.
  Rat   136 KEVQKAMIAFQSEFKCCGLRFGAADWGKNFPDAKESCQCTGSDCESYNGE-----------NVYR 189

  Fly   193 QGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMI 235
            ..||.:....:..:..::.|.:..:|::.|.|::||.:|:..|
  Rat   190 TTCLSLIKELVEKNIIIVIGIAFGLAVIEILGLVFSMVLYCQI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 63/232 (27%)
Tspan8NP_598210.1 Tetraspannin 8..228 CDD:395265 63/232 (27%)
TM4SF3_like_LEL 106..204 CDD:239407 20/108 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X124
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.