DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and tsp-6

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001294830.1 Gene:tsp-6 / 13219712 WormBaseID:WBGene00006632 Length:237 Species:Caenorhabditis elegans


Alignment Length:243 Identity:67/243 - (27%)
Similarity:113/243 - (46%) Gaps:31/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGT------------NL--FSGAV 59
            |..:.|||..::.||:.||.|||:..|::|.|||::.:|.:..|            |:  .:..:
 Worm     5 CGNKCVKYFFWLINFLFFVLGAIIVGLSIWMLVDKNSLNTVASTVKVDLSQILSQVNIQQLNSFL 69

  Fly    60 YVLLVTSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEM 124
            ||.:|....:.::.|.||.|:..|..|.:..|||:|.::||..::..||.:|.:..:||..:...
 Worm    70 YVAIVIGGALLVLGFFGCCGSCCESICAISIYFILVLILFVVEVVAIVLYFVNKTNLQQGFQTIW 134

  Fly   125 RSTM-ALYGSRREITQAWDLTQERLQCCGVDTWHDWNRYGPVPESCCQELFGGQRKECTIFPTIT 188
            |..: :.|.::::|.|..|..|..|||||.....|:..||..|.||          :|      .
 Worm   135 RDELVSKYNTQQQIHQVLDQIQSSLQCCGASGCSDYIPYGAFPTSC----------QC------A 183

  Fly   189 NLYNQGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMIE 236
            .:...||..|..|........:....|.:..:.:..|||||::...::
 Worm   184 TIQQAGCATVIWNSFESSLIYVAFVGIIILFVELLAMIFSCIIIGAVK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 66/231 (29%)
tsp-6NP_001294830.1 Tetraspannin 9..227 CDD:278750 66/233 (28%)
tetraspanin_LEL 120..202 CDD:239401 25/97 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.