DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Cd63

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001036045.1 Gene:Cd63 / 12512 MGIID:99529 Length:238 Species:Mus musculus


Alignment Length:234 Identity:62/234 - (26%)
Similarity:110/234 - (47%) Gaps:19/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 CGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAVYVLLVTSIIICLVSF 74
            |.:|:.|.|.:| |.....|.|...:.:..::.::..:|....:|..   .|::.....:.||:|
Mouse     9 CVKFLLYVLLLA-FCACAVGLIAIGVAVQVVLKQAITHETTAGSLLP---VVIIAVGAFLFLVAF 69

  Fly    75 LGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGSRREITQ 139
            :||.||.||..||::|:.|.::|:.:..:...:.|||||::|:....:..:..|..|....:...
Mouse    70 VGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFNKSFQQQMQNYLKDNKTAT 134

  Fly   140 AWDLTQERLQCCGVDTWHDWNRY-----GPVPESCCQEL---FGGQRKECTIFPTITNLYNQGCL 196
            ..|..|:...|||...:.||...     ..||:|||..:   .|...||.||       :.|||:
Mouse   135 ILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTI-------HTQGCV 192

  Fly   197 YVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMI 235
            .....::|.:..::...::.:|.:.:.|:||||.|...|
Mouse   193 ETIAIWLRKNILLVAAAALGIAFVEVLGIIFSCCLVKSI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 58/224 (26%)
Cd63NP_001036045.1 Tetraspannin 10..227 CDD:395265 59/227 (26%)
CD63_LEL 105..203 CDD:239419 28/104 (27%)
Lysosomal targeting motif. /evidence=ECO:0000269|PubMed:21041449 234..238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.