DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Upk1a

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_081091.1 Gene:Upk1a / 109637 MGIID:98911 Length:257 Species:Mus musculus


Alignment Length:243 Identity:49/243 - (20%)
Similarity:93/243 - (38%) Gaps:41/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGT----NLFSGAVYVLLVTSIIICLVSFLGCV 78
            |.:.|.:|.:.|..:|..|:|...|:..|..|:|.    ::|:|| ::.:.......:|:..|..
Mouse    19 LVVGNIIILLSGLALFAETVWVTADQYRVYPLMGVSGKDDVFAGA-WIAIFCGFSFFVVASFGVG 82

  Fly    79 GAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGS----RREITQ 139
            .|....:.::|||.:::.:|::......:..|..|:.:........:..:..|.:    .:|:|:
Mouse    83 AALCRRRYMILTYLLLMLIVYIFECASCITSYTHRDYMVSNPSLITKQMLTYYSADTDQGQELTR 147

  Fly   140 AWDLTQERLQCCGVDTWHDWNRYG------------PVPESCCQELFGGQRKECTIFPT------ 186
            .||......:|||.....||..|.            |.|..||       |:.....|.      
Mouse   148 LWDRIMIEQECCGTSGPMDWVNYTSAFRAATPEVVFPWPPLCC-------RRTGNFIPINEDGCR 205

  Fly   187 ---ITNLYNQGCLYVTTNFIRDHAAVIGGTSIAVAI----LMIFGMIF 227
               :..|:.:||.....:.|..:...|.....|:.:    :|:..|.|
Mouse   206 VGHMDYLFTKGCFEHIGHAIDSYTWGISWFGFAILMWTLPVMLIAMYF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 49/243 (20%)
Upk1aNP_081091.1 uroplakin_I_like_LEL 111..229 CDD:239409 23/124 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.