DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and Tspan9

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001366065.1 Gene:Tspan9 / 109246 MGIID:1924558 Length:330 Species:Mus musculus


Alignment Length:235 Identity:70/235 - (29%)
Similarity:123/235 - (52%) Gaps:19/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVDR-SFVNELLGTNLFSGAVYVLLVTSIIICLV 72
            ||   :||::|:.|.:.::.|..:..:.:|..|.: :|..........|.|..|:.:.:|:: :.
Mouse    98 CC---LKYTMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANLVIAIGTIVM-VT 158

  Fly    73 SFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMALYGSRREI 137
            .||||:||.||.|||||::||::.::.:..||..:|.:|:.::|.:..:|:::..:.||.:...:
Mouse   159 GFLGCLGAIKENKCLLLSFFIVLLIILLAELILIILFFVYMDKVNENAKQDLKEGLLLYNTENNV 223

  Fly   138 --TQAWDLTQERLQCCGVDTWHDWNRY-----GPVPESCCQELFGGQRKECTIFPTITNLYNQGC 195
              ..||::.|..::||||..:.||  |     ..||:.||.|...|..:..|     |.|:..||
Mouse   224 GLKNAWNIIQAEMRCCGVTDYTDW--YPVLGENTVPDRCCMENSQGCGRNST-----TPLWRTGC 281

  Fly   196 LYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMI 235
            ......:..|:..|:|...:.:.|:.|.||.||..||..|
Mouse   282 YEKVKLWFDDNKHVLGTVGMCILIMQILGMAFSMTLFQHI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 65/224 (29%)
Tspan9NP_001366065.1 Tetraspannin 100..317 CDD:395265 65/224 (29%)
NET-5_like_LEL 196..293 CDD:239418 27/103 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.