DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and TSPAN3

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_005715.1 Gene:TSPAN3 / 10099 HGNCID:17752 Length:253 Species:Homo sapiens


Alignment Length:250 Identity:62/250 - (24%)
Similarity:110/250 - (44%) Gaps:42/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MDCCGQFVKYSLFIANFVIFVGGAIVFC------LTLWTLVDRSFVNELLGTNLFSGAVYVLLVT 65
            |..||.....::.:...:||.|.|.:.|      ...:...|..|.:           ||.|:..
Human     1 MGQCGITSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFED-----------VYTLIPA 54

  Fly    66 SIIIC------LVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEM 124
            .:||.      ::..:||....:|.:|.|.|:.||:.|||||.::..|||||:|.:|:..:.:.:
Human    55 VVIIAVGALLFIIGLIGCCATIRESRCGLATFVIILLLVFVTEVVVVVLGYVYRAKVENEVDRSI 119

  Fly   125 RSTMALYGSRR--EITQAWDLTQERLQCCGVDTWHDW--------NRYGPVPESCCQELFGGQRK 179
            :.....|....  ..::|.|..|.:|.|||:..:.||        .:...||.|||:|    ...
Human   120 QKVYKTYNGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRE----TAS 180

  Fly   180 ECT---IFPTITNLYNQGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLL 231
            .|.   ..|  ::||.:||..:....:::....:...::|.|.:.:.||:.:|::
Human   181 NCNGSLAHP--SDLYAEGCEALVVKKLQEIMMHVIWAALAFAAIQLLGMLCACIV 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 59/241 (24%)
TSPAN3NP_005715.1 Tetraspannin 9..232 CDD:395265 58/239 (24%)
TM4SF8_like_LEL 104..210 CDD:239416 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.