DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and cd151

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:XP_031755690.1 Gene:cd151 / 100144686 XenbaseID:XB-GENE-480009 Length:266 Species:Xenopus tropicalis


Alignment Length:258 Identity:75/258 - (29%)
Similarity:131/258 - (50%) Gaps:29/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FSSRMDCCGQF-VKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTNLFSGAVYVLLVTS 66
            ::.:.:.||.. :||.||..||..::.|..|..:.:|||:.:|....||.:|.::...|:|::..
 Frog    10 YNEKKETCGTICLKYLLFTFNFFFWLAGLAVMAVGIWTLIQKSDYISLLPSNTYAATAYILVIAG 74

  Fly    67 IIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRER-----------VQQTM 120
            .|:.:...|||....||.|.||..|||::..:|:..::.|:|.|::.::           ::|::
 Frog    75 AIVMITGILGCCATFKERKSLLKVYFILLLCIFILEVLAGILAYIYYQQCTPFCLQLNAELKQSL 139

  Fly   121 RQEMRSTMALYGSRREITQAWDLTQERLQCCGVDTWHDWNR----YGP------VPESCCQELFG 175
            :|.|.:.....|..: :|.|.|..|:..:|||.:...||..    ..|      ||:|||:.:  
 Frog   140 KQTMTTKYKQPGEEK-VTNAVDKLQQEFKCCGSNNSEDWRDSIWINSPEAEKRLVPDSCCKTV-- 201

  Fly   176 GQRKECTIFPTITNLYNQ--GCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMIE 236
              .:.|.|....:|:|..  ||:.....|||.|..:||...|.:|.:.:|||||:|.|:..::
 Frog   202 --TQRCGIRDHPSNIYKTEGGCITKLETFIRAHLLIIGAVGIGIACVQLFGMIFTCCLYRSLK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 72/239 (30%)
cd151XP_031755690.1 Tetraspannin 22..257 CDD:395265 72/239 (30%)
CD151_like_LEL 118..233 CDD:239408 29/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I5013
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20916
Inparanoid 1 1.050 136 1.000 Inparanoid score I4439
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051357at2759
OrthoFinder 1 1.000 - - FOG0002118
OrthoInspector 1 1.000 - - otm47627
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 1 1.000 - - X124
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.