DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and cd37

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001096092.1 Gene:cd37 / 100124595 ZFINID:ZDB-GENE-070820-17 Length:249 Species:Danio rerio


Alignment Length:241 Identity:62/241 - (25%)
Similarity:120/241 - (49%) Gaps:23/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DCCGQFVKYSLFIANFVIFVGGAIVFCLTLWTLVD-----RSFVNEL---LGTNLFSGAVYVLLV 64
            :||....||.||:.|.|.|:.|:::....||.|:.     ::|::..   :..:|.|   |:|::
Zfish     4 ECCVSVTKYFLFLFNLVFFLLGSLLLSSGLWMLLSDTSEIKTFIDPFRPYISISLLS---YLLII 65

  Fly    65 TSIIICLVSFLGCVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQTMRQEMRSTMA 129
            :..:...:.|.||:|:.|.||.||..|||::.::....::||||.|..:..:.:::.:|.....:
Zfish    66 SGSVTMSLGFFGCLGSLKTVKFLLAIYFILLTVLLAAQIVGGVLFYTMKTELSKSLGKETDLIQS 130

  Fly   130 LYGSRREITQAWDLTQERLQCCGVDTWHDWNRYGPVPESCCQELFGGQRKE----CT---IFPTI 187
            ...:.....:..|..|.:.:|||.:...||.  ..:|.||..:  ..:.||    |:   .:|.:
Zfish   131 FGRNDSSFKKTMDYIQRQEECCGWNGKEDWG--DSIPCSCYHK--ANETKELCDNCSPDFFYPVL 191

  Fly   188 T-NLYNQGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLF 232
            : .:|::||.....|::..:...|....:|::::.|.|||.|..|:
Zfish   192 SCKIYDEGCKDKVENWLGSNLHFILWVILAISVVEICGMILSMSLY 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 59/232 (25%)
cd37NP_001096092.1 Tetraspannin 55..238 CDD:278750 48/190 (25%)
tetraspanin_LEL 110..212 CDD:243179 20/105 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.