DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp74F and tspan18

DIOPT Version :9

Sequence 1:NP_524132.1 Gene:Tsp74F / 39995 FlyBaseID:FBgn0036769 Length:236 Species:Drosophila melanogaster
Sequence 2:NP_001093673.1 Gene:tspan18 / 100101661 XenbaseID:XB-GENE-868385 Length:247 Species:Xenopus tropicalis


Alignment Length:245 Identity:76/245 - (31%)
Similarity:123/245 - (50%) Gaps:28/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VKYSLFIANFVIFVGGAIVFCLTLWTLVDRSFVNELLGTN--LFSGAVYVLLVTSIIICLVSFLG 76
            :||.:||.||.||:|||.:..|.:|..||.:...|::.|.  ||.|| |::|....::.|:.|||
 Frog     9 IKYLMFIFNFFIFLGGATLLGLGVWVFVDPTGFREIIATTPLLFMGA-YLVLAMGGMLFLLGFLG 72

  Fly    77 CVGAGKEVKCLLLTYFIIVALVFVTMLIGGVLGYVFRERVQQT-MRQEMRSTMALYGSRREITQA 140
            |.||.:|.||||:.:|:.:.::|:..|...:|.::|||.:.:. ..:|::.......|....:..
 Frog    73 CCGAIRENKCLLVFFFMFILVIFLAELSAAILAFLFRENLSKDFFAREVKKHYHGDNSTEVFSST 137

  Fly   141 WDLTQERLQCCGVDTWHDWN---------RYGPVPESCCQELFGGQ------RKECTIFPTIT-- 188
            |:.......||||:...|:|         .:.||||:||:.....:      |.||     :|  
 Frog   138 WNSIMITFGCCGVNGPEDFNDAHRFRAMHPFAPVPEACCRREVQSRAGKIVSRAEC-----LTGG 197

  Fly   189 -NLYN-QGCLYVTTNFIRDHAAVIGGTSIAVAILMIFGMIFSCLLFNMIE 236
             |..| |||..|..|.:..:..:.|..:|.|..:.:..|:|:..||..|:
 Frog   198 ENYQNRQGCYSVIVNSVEPYVYIAGALAIGVLAIELLSMVFAMCLFRGIQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp74FNP_524132.1 Tetraspannin 14..231 CDD:395265 73/238 (31%)
tspan18NP_001093673.1 Tetraspannin 9..242 CDD:395265 73/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X124
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.