DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7402 and SGSH

DIOPT Version :9

Sequence 1:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_000190.1 Gene:SGSH / 6448 HGNCID:10818 Length:502 Species:Homo sapiens


Alignment Length:575 Identity:130/575 - (22%)
Similarity:210/575 - (36%) Gaps:156/575 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSLAYGSGYSTKPNIVIILIDDMGMNDVSFHGSNQILTPNIDALAYNGILLNKHYVP-NLCTPSR 79
            |.|..|...:...|.:::|.||.|....:::.| .|.||::||||...:|....:.. :.|:|||
Human    11 LLLVLGLCRARPRNALLLLADDGGFESGAYNNS-AIATPHLDALARRSLLFRNAFTSVSSCSPSR 74

  Fly    80 ATLLT-------GKYPIHTGMQHFVIITDEPWGLPQRERLMPEIFRDAGYSTHLVGKWHLGFWRK 137
            |:|||       |.|.:|..:.||...        .:.|.:|.:...||..|.::||.|:|    
Human    75 ASLLTGLPQHQNGMYGLHQDVHHFNSF--------DKVRSLPLLLSQAGVRTGIIGKKHVG---- 127

  Fly   138 DLTPTMRGFDHHFGYYNGYIDYYDH---QVRMLDRNYSAGLDFR--------RDLEPCPEANGTY 191
              ..|:..||..:...||.:.....   ::::|.|.:....|.|        .|...|..:...|
Human   128 --PETVYPFDFAYTEENGSVLQVGRNITRIKLLVRKFLQTQDDRPFFLYVAFHDPHRCGHSQPQY 190

  Fly   192 AT--EAF---TSEAKRIIEQHDKS-KPLFMVLSHLAVHTGNEDSPMQAPEEEVAKFPHIRDPKRR 250
            .|  |.|   .|...||.:...:: .||.:::.:...:|                 |..|.....
Human   191 GTFCEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNT-----------------PAARADLAA 238

  Fly   251 TYAGMISSLDKSVAQTIGALKDNGMLNNSIILLYSDNGAPTIGIHSNAGSNYPYRGQKESPWEGG 315
            .|. .:..:|:.|...:..|:|.|:||:::::..||||.|           :| .|:....|.|.
Human   239 QYT-TVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIP-----------FP-SGRTNLYWPGT 290

  Fly   316 IRSAGALWSPLL-------KERGYVSNQAIHAVDWLPTLAGAAGVSLP-------QDLPLDGINL 366
            .       .|||       |..|.||...:..:|..||:.....:..|       :.:.|.|.:|
Human   291 A-------EPLLVSSPEHPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSL 348

  Fly   367 WPMLSGNEEPKPRTMIHVLDEVFGYSSYMRDTLKYVNGSSFKGRYDQWLGELETNEDDPLGESYE 431
            .|.|..  ||...|       |||..|:...|:.|.. .|.:.|:.:.:..|......|:.:.: 
Human   349 LPALEA--EPLWAT-------VFGSQSHHEVTMSYPM-RSVQHRHFRLVHNLNFKMPFPIDQDF- 402

  Fly   432 QHVLASDVQSLLGNRGLTKDRIRQMRSEATETCPPIEGQNPLESHF---KCEPLKAPCFFDLAKD 493
              .::...|.|| ||              |....|......|..::   :.|      .:|.::|
Human   403 --YVSPTFQDLL-NR--------------TTAGQPTGWYKDLRHYYYRARWE------LYDRSRD 444

  Fly   494 PCERYNLA--QMYPLQLQQLADELEQIRKTAIPSARVPHSDSRANPTFHNGNWEW 546
            |.|..|||  ..:...|:.|.|:|                          ..|:|
Human   445 PHETQNLATDPRFAQLLEMLRDQL--------------------------AKWQW 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 110/472 (23%)
4-S 28..436 CDD:293753 105/446 (24%)
SGSHNP_000190.1 SGSH 24..472 CDD:293751 125/559 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.