DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7402 and sgsh

DIOPT Version :9

Sequence 1:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_001116740.1 Gene:sgsh / 563849 ZFINID:ZDB-GENE-030131-4958 Length:511 Species:Danio rerio


Alignment Length:549 Identity:129/549 - (23%)
Similarity:215/549 - (39%) Gaps:132/549 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LSLAYGSGYSTKPNIVIILIDDMGMNDVSFHGSNQILTPNIDALAYNGILLNKHYVP-NLCTPSR 79
            |.|.:..|.....|:::|:.||.|. :...:.:..:.||::.||:...::....:.. :.|:|||
Zfish    12 LLLCFDVGGCRSRNVLLIIADDGGF-ETDVYNNTVVQTPHLRALSKRSLIFKNAFTSVSSCSPSR 75

  Fly    80 ATLLT-------GKYPIHTGMQHFVIITDEPWGLPQRERLMPEIFRDAGYSTHLVGKWHLGFWRK 137
            :|:||       |.|.:|.|:.||....    |:    :.:|.:.:.|...|.::||.|:|    
Zfish    76 STILTGLPQHQNGMYGLHQGVHHFNSFD----GV----QSLPLLLKRANIHTGIIGKKHVG---- 128

  Fly   138 DLTPTMRGFDHHFGYYNGYIDYYDHQVRMLDRNYS-AGLDFRRDLEPCPEANGTYATEAFTSEAK 201
              ...:..||  |.|..     ..:.|..:.||.: ..|..|:..:...|..         ||.|
Zfish   129 --PGPVYPFD--FAYTE-----ETNSVLQVGRNITKIKLLVRKFFQSHKEER---------SETK 175

  Fly   202 RIIEQHDKSKPLFMVLS----HLAVHT-----------GNEDSPM-QAPEEE-------VAKFPH 243
                   :.:|.|:.::    |...|:           ||.:|.| :.|:.|       ..|.|:
Zfish   176 -------EERPFFLYVAFHDPHRCGHSQPQYGVFCEKFGNGESGMGRIPDWEPKYYSPDQVKVPY 233

  Fly   244 -IRD-PKRRT-----YAGMISSLDKSVAQTIGALKDNGMLNNSIILLYSDNGAPTIGIHSNAGSN 301
             |.| |..|.     |. .:|.||:.:...:..|:..|..|:::::..||||.|    ..|..:|
Zfish   234 FIPDTPAARADIAAQYT-TVSRLDQGIGLVLEELRKAGFENDTLVIYSSDNGIP----FPNGRTN 293

  Fly   302 YPYRGQKESPWEGGIRSAGALWSPLLKER-GYVSNQAIHAVDWLPTLAG-------AAGVSLPQD 358
            .         :..|::....|.||..::| |.:|...:..:|..||:..       :..:|:.|.
Zfish   294 L---------YGSGVKEPMLLSSPEHQQRWGKLSQAYVSLLDITPTILDWFSLPYPSYSLSMSQP 349

  Fly   359 LPLDGINLWPMLSGNEEPKPRTMIHVLDEVFGYSSYMRDTLKYVNGSSFKGRYDQWLGELETNED 423
            :.|.|.:|.|.|.  .||.       .|.||...|....|:.|...|..||.| :.|..|.....
Zfish   350 VELTGRSLLPALI--SEPS-------WDTVFSSQSLHEVTMFYPMRSIHKGPY-RLLHNLHYRMP 404

  Fly   424 DPLGESYEQHVLASDVQSLLGNRGLTKDRIRQMRSEATETCPPIEGQNPLESHFKCEPLKAPCFF 488
            .|:.:.:   .::...|.|| ||              |::..|......|..::..:..:   .|
Zfish   405 FPIDQDF---YISPTFQDLL-NR--------------TQSGRPTGWFKTLNEYYYRQRWE---LF 448

  Fly   489 DLAKDPCERYNLA--QMYPLQLQQLADEL 515
            |:..||.|:.|||  ..|...|:.|.|.|
Zfish   449 DVRTDPMEKVNLAGDLDYSEVLESLKDLL 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 110/480 (23%)
4-S 28..436 CDD:293753 105/454 (23%)
sgshNP_001116740.1 SGSH 25..481 CDD:293751 126/536 (24%)
AslA 25..461 CDD:225661 119/518 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.