DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7402 and SULF2

DIOPT Version :9

Sequence 1:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_001373981.1 Gene:SULF2 / 55959 HGNCID:20392 Length:871 Species:Homo sapiens


Alignment Length:672 Identity:131/672 - (19%)
Similarity:227/672 - (33%) Gaps:211/672 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVLLVVSSILSLAYGSG----------------YSTKPNIVIILIDDMGMNDVSFHGSNQILTP 54
            :::.|:.:::.||..||.                .:.:|||:::|.||   .||.. ||.|::..
Human     6 LVLCLLSATVFSLLGGSSAFLSHHRLKGRFQRDRRNIRPNIILVLTDD---QDVEL-GSMQVMNK 66

  Fly    55 NIDALAYNGI-LLNKHYVPNLCTPSRATLLTGKYPIHTGMQHFVIITDE-----PWGLPQRERLM 113
            ....:...|. .:|......:|.|||:::||||| :|   .|.....:|     .|......|..
Human    67 TRRIMEQGGAHFINAFVTTPMCCPSRSSILTGKY-VH---NHNTYTNNENCSSPSWQAQHESRTF 127

  Fly   114 PEIFRDAGYSTHLVGKWHLGFWRKDLTPTMRGFDHHFGYYNG-YID--------------YYDHQ 163
            .......||.|...||                   :...||| |:.              :|::.
Human   128 AVYLNSTGYRTAFFGK-------------------YLNEYNGSYVPPGWKEWVGLLKNSRFYNYT 173

  Fly   164 VRMLDRNYSAGLDFRRDLEPCPEANGTYATEAFTSEAKRIIEQHDK---SKPLFMVLSHLAVHTG 225
            :.........|.|:.:|          |.|:..|:::........|   .:|:.||:||.|.| |
Human   174 LCRNGVKEKHGSDYSKD----------YLTDLITNDSVSFFRTSKKMYPHRPVLMVISHAAPH-G 227

  Fly   226 NEDSPMQ------------------APEEE---VAKFPHIRDPKRRTYAGMIS--------SLDK 261
            .|||..|                  ||..:   :.::.....|....:..|:.        |:|.
Human   228 PEDSAPQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSVDD 292

  Fly   262 SVAQTIGALKDNGMLNNSIILLYSDNGAPTIGIHSNAGSNYPYRGQ------KESPWEGGIRSAG 320
            |:......|.:.|.|:|:.|:..:|:|.              :.||      |..|:|..||...
Human   293 SMETIYNMLVETGELDNTYIVYTADHGY--------------HIGQFGLVKGKSMPYEFDIRVPF 343

  Fly   321 ALWSPLLKERGYVSNQAIHAVDWLPTLAGAAGVSLPQDLPLDGINLWPMLSGNEEPKPRTMIHVL 385
            .:..|.: |.|.::...:..:|..||:...||:.:|.|  :||.::..:|               
Human   344 YVRGPNV-EAGCLNPHIVLNIDLAPTILDIAGLDIPAD--MDGKSILKLL--------------- 390

  Fly   386 DEVFGYSSYMRDTLKYVNGSSFKGRYDQW-------LGELETNEDDPLGESYEQHVLASDVQSLL 443
                       ||.:.||....|.:...|       .|:|....|:...::.|::.|..      
Human   391 -----------DTERPVNRFHLKKKMRVWRDSFLVERGKLLHKRDNDKVDAQEENFLPK------ 438

  Fly   444 GNRGLTKDRIRQM--RSEATETCPPI--------EGQNPLESHFKCE-PLK----------APCF 487
                  ..|::.:  |:|....|..:        :....|:.| ||: |::          .|.:
Human   439 ------YQRVKDLCQRAEYQTACEQLGQKWQCVEDATGKLKLH-KCKGPMRLGGSRALSNLVPKY 496

  Fly   488 FDLAKDPCE------RYNLA----QMYPLQLQQLADELEQIRKTAIP-SARVPH---SDSRANPT 538
            :....:.|.      :.:||    :::..:.:........||..||. ..||.|   .|:.....
Human   497 YGQGSEACTCDSGDYKLSLAGRRKKLFKKKYKASYVRSRSIRSVAIEVDGRVYHVGLGDAAQPRN 561

  Fly   539 FHNGNWEWWNNTDTQSGSGTFS 560
            ....:|............|.||
Human   562 LTKRHWPGAPEDQDDKDGGDFS 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 103/501 (21%)
4-S 28..436 CDD:293753 100/473 (21%)
SULF2NP_001373981.1 G6S 43..385 CDD:293766 89/396 (22%)
DUF3740 529..662 CDD:403667 12/55 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 560..588 4/24 (17%)
ALP_like <750..799 CDD:419962
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157130
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.