DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7402 and Sgsh

DIOPT Version :9

Sequence 1:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_650760.1 Gene:Sgsh / 42266 FlyBaseID:FBgn0038660 Length:524 Species:Drosophila melanogaster


Alignment Length:578 Identity:136/578 - (23%)
Similarity:225/578 - (38%) Gaps:161/578 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILSLAYGSGYSTKP-NIVIILIDDMGMNDVSFHGSNQIL-TPNIDALAYNGILLNKHYVP-NLCT 76
            |.:|...:|.|..| |::::|.||.|....::  .|:.. |||:||||..|:|.|..:.. :.|:
  Fly     7 IFTLWLIAGCSAGPQNVLLLLADDAGFESGAY--LNKFCQTPNLDALAKRGLLFNNAFTSVSSCS 69

  Fly    77 PSRATLLTGK-------YPIHTGMQHFVIITDEPWGLPQRERLMPEIFRDAG---YSTHLVGKWH 131
            |||:.||||:       |.:|.|:.:|.::.|        ...:|.:.||..   ..:.::||.|
  Fly    70 PSRSQLLTGQAGHSSGMYGLHQGVHNFNVLPD--------TGSLPNLIRDQSGGRILSGIIGKKH 126

  Fly   132 LGF---WRKDLTPTMRGFDHHFGYYNGYIDYYDHQVRMLDRNYSAGLDFRRDLEPCPEANGTYAT 193
            :|.   :|.|...|..                .|.:..:.||.:...::.|.             
  Fly   127 VGAANNFRFDFEQTEE----------------QHSINQIGRNITRMKEYARQ------------- 162

  Fly   194 EAFTSEAKRIIEQHDKSKPLFMVL--------SHLAVHTG------------------------- 225
              |..:||      |:.||.|:::        .|:....|                         
  Fly   163 --FLKQAK------DEKKPFFLMVGFHDPHRCGHITPQFGEFCERWGSGEEGMGSIPDWKPIYYD 219

  Fly   226 --NEDSPMQAPEEEVAKFPHIRDPKRRTYAGMISSLDKSVAQTIGALKDNGMLNNSIILLYSDNG 288
              |.|.|...|:.:|     :|......|. .||.||:.|...:..|:..|:.:.::::..||||
  Fly   220 WRNLDVPAWLPDTDV-----VRQELAAQYM-TISRLDQGVGLMLKELEAAGVADQTLVIYTSDNG 278

  Fly   289 APTIGIHSNAGSNYPYRGQKESPWEGGIRSAGALWSPLLKERGYVSNQA-IHAVDWLPTLAGAAG 352
            .             |:.|.:.:.:|.||||...:.||..::|.:.:..| :..:|..|::..|..
  Fly   279 P-------------PFPGGRTNLYEHGIRSPLIISSPNKEDRHHEATAAMVSLLDIYPSVMDALQ 330

  Fly   353 VSLPQDLPLDGINLWPMLSGNEEPKPRTMIHVLDEVFGYSSYMRDTLKYVNGSSFKGRY------ 411
            :..|.|..:.|.::.|:|  .|||.    |...|.|||..||...|:.|........||      
  Fly   331 IPRPNDTKIVGRSILPVL--REEPP----IKESDSVFGSHSYHEVTMAYPMRMVRNRRYKLIHNI 389

  Fly   412 DQWLGELETNEDDPLGESYEQHVLASDVQSLLGNRGLTKDRIRQMRSEATETCPPIEGQNPLESH 476
            :.|       .|.|:.:.:   ..:...|.:| |..|.|..:...||              |..:
  Fly   390 NYW-------ADFPIDQDF---YTSPTFQQIL-NATLRKQTLPWYRS--------------LLQY 429

  Fly   477 FKCEPLKAPCFFDLAKDPCERYNLAQ--MYPLQLQQLADELEQIR-KTAIPSARVPHS 531
            ::....:   .:|:..||.||:|||.  .|...|:||.::|...: .|..|....||:
  Fly   430 YQRPEWE---LYDIKTDPLERFNLADKAKYNGTLKQLREQLFDWQVATKDPWRCAPHA 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 114/491 (23%)
4-S 28..436 CDD:293753 107/465 (23%)
SgshNP_650760.1 AslA 17..476 CDD:225661 130/558 (23%)
SGSH 22..471 CDD:293751 127/548 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466502
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.