DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7402 and CG18278

DIOPT Version :9

Sequence 1:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_725289.1 Gene:CG18278 / 36487 FlyBaseID:FBgn0033836 Length:492 Species:Drosophila melanogaster


Alignment Length:558 Identity:133/558 - (23%)
Similarity:209/558 - (37%) Gaps:135/558 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVLLVVSSILSLAYGSGYSTK-PNIVIILIDDMGMNDVSFHGSNQILTP---NIDALAYNGILLN 67
            |::||::.:     |:..|.| |||::||.||   .||...|    :.|   .|:.|.:.|.|.:
  Fly     7 LIILVLACL-----GNTASEKLPNILLILSDD---QDVELRG----MFPMEHTIEMLGFGGALFH 59

  Fly    68 KHYVPN-LCTPSRATLLTGKYPIHTGMQHFVI---ITDEPWGLPQRERLMPEIFRDAGYSTHLVG 128
            ..|.|: :|.|:|.:||||.|..:.|.::..:   .....|......|.:|.|.:..||:|...|
  Fly    60 NAYTPSPICCPARTSLLTGMYAHNHGTRNNSVSGGCYGPHWRRALEPRALPYILQQHGYNTFFGG 124

  Fly   129 KWHLGFWRKDLTPTMRGFDHHFGYYNGYIDYYDHQVRMLDRNYSAGLDFRRDLEPCPEANGTYAT 193
            |:...:|.....|  :|::|.:|.: |...||::.:|....|.              ....||.|
  Fly   125 KYLNQYWGAGDVP--KGWNHFYGLH-GNSRYYNYTLRENSGNV--------------HYESTYLT 172

  Fly   194 EAFTSEAKRIIEQ-HDKSKPLFMVLSHLAVHTGNEDSPM-QAPEEEVAKFPHI---RDPK----- 248
            :.....|...:.. ...|:|.|.:::..|.|     .|. .||..| ..|.||   |.|.     
  Fly   173 DLLRDRAADFLRNATQSSEPFFAMVAPPAAH-----EPFTPAPRHE-GVFSHIEALRTPSFNQVK 231

  Fly   249 ----------RR----------TYA----GMISSLDKSVAQTIGALKDNGMLNNSIILLYSDNGA 289
                      ||          ||.    ..:.::|:.|...:|.|.|...|.|:.|:..|||  
  Fly   232 QDKHWLVRAARRLPNETINTIDTYFQKRWETLLAVDELVVTLMGVLNDTQSLENTYIIYTSDN-- 294

  Fly   290 PTIGIHSNAGSNYPYRGQKESPWEGGIRSAGALWSPLLKERGYVSNQAIHAVDWLPTLAGAAGVS 354
               |.|....:. |:  .|..|:|..|.....:..|.:....:: :.|:..||..||:...|.:.
  Fly   295 ---GYHVGQFAQ-PF--DKRQPYETDINVPLLIRGPGIAPESHI-DTAVSLVDLAPTILAWADID 352

  Fly   355 LPQDLPLDGINLWPMLSGNEEPKPRTMIHVLDEVFGYSSYMRDTLKYVNGS---SFKGRYDQWLG 416
            .|.  .:||.:...:|.......|.....:|.|.:|     ..||...|..   ..|.|..|...
  Fly   353 TPS--YMDGQSFHELLLNKRRRVPFFERSLLIEYWG-----EGTLATFNPECPWPEKDRLAQCTP 410

  Fly   417 ELETNEDDPLGESYEQHVLASDVQSLLGNRGLTKDRIRQMRSEATETCPPIEGQNPLESHFKCEP 481
            ..:.:..|....:|          :.|.|....:|||         .|...:.:|.||:      
  Fly   411 AADCHCQDAWNNTY----------ACLRNIRHREDRI---------YCEFRDNENFLEA------ 450

  Fly   482 LKAPCFFDLAKDPCERYNLA--------QMYPLQLQQL 511
                  :||..||.:..|:|        .:|.|:|:.|
  Fly   451 ------YDLQLDPFQMTNIAYDLLPIERALYSLRLKNL 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 115/478 (24%)
4-S 28..436 CDD:293753 108/451 (24%)
CG18278NP_725289.1 G6S 24..467 CDD:293766 123/519 (24%)
AslA 24..464 CDD:225661 122/516 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466490
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.