DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7402 and ARSH

DIOPT Version :9

Sequence 1:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_001011719.1 Gene:ARSH / 347527 HGNCID:32488 Length:562 Species:Homo sapiens


Alignment Length:624 Identity:154/624 - (24%)
Similarity:230/624 - (36%) Gaps:170/624 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 STKPNIVIILIDDMGMNDVSFHGSNQILTPNIDALAYNGILLNKHY-VPNLCTPSRATLLTGKYP 88
            :.:||||:::.||:|:.|:..:|:|.:.|||||.||..|:.|.:|. ..::||||||..|||:||
Human     4 NARPNIVLLMADDLGVGDLCCYGNNSVSTPNIDRLASEGVRLTQHLAAASMCTPSRAAFLTGRYP 68

  Fly    89 IHTGM-QHFVIITDEPW-----GLPQRERLMPEIFRDAGYSTHLVGKWHLGF---WRKD--LTPT 142
            |.:|| ..:.:.....|     |||..|....::.:..||.|.|:||||||.   .|.|  ..|.
Human    69 IRSGMVSAYNLNRAFTWLGGSGGLPTNETTFAKLLQHRGYRTGLIGKWHLGLSCASRNDHCYHPL 133

  Fly   143 MRGFDHHFG-------------------------------------------------------- 151
            ..||.:.:|                                                        
Human   134 NHGFHYFYGVPFGLLSDCQASKTPELHRWLRIKLWISTVALALVPFLLLIPKFARWFSVPWKVIF 198

  Fly   152 --------YYNGYIDYYDHQVR---MLDRNYSAGLDFRRDLEPCPEANGTYATEAFTSEAKRIIE 205
                    ::..:...|....|   :|.||:..      ..:|..|..   .......||...||
Human   199 VFALLAFLFFTSWYSSYGFTRRWNCILMRNHEI------IQQPMKEEK---VASLMLKEALAFIE 254

  Fly   206 QHDKSKPLFMVLSHLAVHTGNEDSPMQAPEEEVAKFPHIRDPKRRTYAGMISSLDKSVAQTIGAL 270
            :: |.:|..:..|.|.|||     |:      ::|...:...|...|...:..:|..|.:.:.||
Human   255 RY-KREPFLLFFSFLHVHT-----PL------ISKKKFVGRSKYGRYGDNVEEMDWMVGKILDAL 307

  Fly   271 KDNGMLNNSIILLYSDNGA---PTIGIHSNAGSNYPYRGQK-ESPWEGGIRSAGALWSPLLKERG 331
            ....:.|::::...||||.   |..|.....|.|..|:|.| ...||||||..|....|.:.|.|
Human   308 DQERLANHTLVYFTSDNGGHLEPLDGAVQLGGWNGIYKGGKGMGGWEGGIRVPGIFRWPSVLEAG 372

  Fly   332 YVSNQAIHAVDWLPTLAGAAGVSLPQDLPLDGINLWPMLSGNEEPKPRTMIHVLDEVFGYSSYMR 396
            .|.|:....:|..|||:...|..|.||..:||.||.|:|.|.........:      |.|.....
Human   373 RVINEPTSLMDIYPTLSYIGGGILSQDRVIDGQNLMPLLEGRASHSDHEFL------FHYCGVYL 431

  Fly   397 DTLKYVNGSSFKGRYDQWLGELETNEDDP--LGESYEQHVLASDVQSLLGNRGLTKDRIRQMRSE 459
            .|:::..    |.....|.....|.:..|  .|..|     .|.:.|..|              :
Human   432 HTVRWHQ----KDCATVWKAHYVTPKFYPEGTGACY-----GSGICSCSG--------------D 473

  Fly   460 ATETCPPIEGQNPLESHFKCEPLKAPCFFDLAKDPCERYNL----AQMYPLQLQQLADELEQIRK 520
            .|...||:                   .||:::||.|...|    ..::...::::...:.:.|:
Human   474 VTYHDPPL-------------------LFDISRDPSEALPLNPDNEPLFDSVIKKMEAAIREHRR 519

  Fly   521 TAIPSARVPHSDSRANPTFHNGNWEWWNNTDTQSGSGTF 559
            |..|   ||...|     ..|..|:.|    .|...|||
Human   520 TLTP---VPQQFS-----VFNTIWKPW----LQPCCGTF 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 132/518 (25%)
4-S 28..436 CDD:293753 129/492 (26%)
ARSHNP_001011719.1 ALP_like 6..530 CDD:304875 147/600 (25%)
AslA 6..437 CDD:225661 123/457 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157177
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.