DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7402 and sulf2b

DIOPT Version :9

Sequence 1:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:XP_009294986.2 Gene:sulf2b / 322056 ZFINID:ZDB-GENE-030131-775 Length:1293 Species:Danio rerio


Alignment Length:142 Identity:29/142 - (20%)
Similarity:47/142 - (33%) Gaps:41/142 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 SGNEEPKPRTMIHVLDEVFG-----YSSYMR----DTLKYVNGSSFKGRYDQWLGELETNEDDPL 426
            |..|..|||      |.:||     |..|.:    :|:.|::   |...|.    .:.:.:..|:
Zfish   842 SAPERLKPR------DALFGGRTNAYKLYHKVGEGETISYLD---FTSLYP----FIMSTKTYPI 893

  Fly   427 GESYEQHVLASDVQSLLGNRGLTKDRIRQMRS----------------EATETCPPIEGQNPLES 475
            |   ...::.:|.|.:....||.|..:...|.                ....||...|.|....:
Zfish   894 G---HPEIIFNDFQPIENYYGLIKATVYPPRKLLHPVLPYRCAGKLMFPLCRTCAHAENQTSRCN 955

  Fly   476 HFKCEPLKAPCF 487
            |...|...:.|:
Zfish   956 HTDDERALSGCW 967

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 22/112 (20%)
4-S 28..436 CDD:293753 16/73 (22%)
sulf2bXP_009294986.2 DNA_pol_B_2 519..1146 CDD:332879 29/142 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592840
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.