DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7402 and Sulf2

DIOPT Version :9

Sequence 1:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_001030099.1 Gene:Sulf2 / 311642 RGDID:1305078 Length:875 Species:Rattus norvegicus


Alignment Length:559 Identity:111/559 - (19%)
Similarity:202/559 - (36%) Gaps:166/559 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVVSSILSLAYGSG----------------YSTKPNIVIILIDDMGMNDVSFHGSNQILTPNIDA 58
            |:.:::.||..||.                .:.:|||:::|.||   .||.. ||.|::......
  Rat    10 LLSTALFSLLAGSSAFLSYPRLKGRFQRDRRNIRPNIILVLTDD---QDVEL-GSMQVMNKTRRI 70

  Fly    59 LAYNGI-LLNKHYVPNLCTPSRATLLTGKYPIHTGMQHFVIITDE-----PWGLPQRERLMPEIF 117
            :...|. .:|......:|.|||:::||||| :|   .|.....:|     .|......|......
  Rat    71 MEQGGAHFINAFVTTPMCCPSRSSILTGKY-VH---NHNTYTNNENCSSPSWQAQHESRTFAVYL 131

  Fly   118 RDAGYSTHLVGKWHLGFWRKDLTPTMRGFDHHFGYYNG-YID--------------YYDHQVRML 167
            ...||.|...||                   :...||| |:.              :|::.:...
  Rat   132 NSTGYRTAFFGK-------------------YLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRN 177

  Fly   168 DRNYSAGLDFRRDLEPCPEANGTYATEAFTSEAKRIIEQHDK---SKPLFMVLSHLAVHTGNEDS 229
            ......|.|:..|          |.|:..|:::........|   .:|:.||:||.|.| |.|||
  Rat   178 GMKEKHGSDYSTD----------YLTDLITNDSVSFFRTSKKMYPHRPVLMVISHAAPH-GPEDS 231

  Fly   230 PMQ------------------APEEE---VAKFPHIRDPKRRTYAGMIS--------SLDKSVAQ 265
            ..|                  ||..:   :.::.....|....:..|:.        |:|.|:..
  Rat   232 APQYSRLFPNASQHITPSYNYAPNPDKHWIMRYTGPMKPIHMEFTNMLQRKRLQTLMSVDDSMET 296

  Fly   266 TIGALKDNGMLNNSIILLYSDNGAPTIGIHSNAGSNYPYRGQ------KESPWEGGIRSAGALWS 324
            ....|.:.|.|:|:.|:..:|:|.              :.||      |..|:|..||....:..
  Rat   297 IYDMLVETGELDNTYIVYTADHGY--------------HIGQFGLVKGKSMPYEFDIRVPFYVRG 347

  Fly   325 PLLKERGYVSNQAIHAVDWLPTLAGAAGVSLPQDLPLDGINLWPMLSGNEEPKPRTMIHVLDEVF 389
            |.: |.|.::...:..:|..||:...||:.:|.|  :||.::..:|   :..:|....|:..::.
  Rat   348 PSV-EAGSLNPHIVLNIDLAPTILDIAGLDIPAD--MDGKSILKLL---DSERPVNRFHLKKKLR 406

  Fly   390 GY-SSYMRDTLKYVN---GSSFKGRYDQWLGELETNED-----------DPLGESYEQHVLASDV 439
            .: .|::.:..|.::   |.....:.:.:|.:.:..:|           :.||:.::   ...|.
  Rat   407 VWRDSFLVERGKLLHKREGDKVNAQEENFLPKYQRVKDLCQRAEYQTACEQLGQKWQ---CVEDA 468

  Fly   440 QSLL--------------GNRGLTKDRIRQMRSEATETC 464
            ...|              |:|.|: :.:.:...:::|.|
  Rat   469 SGALKLHKCKGPVRFGGGGDRALS-NLVPKYDGQSSEAC 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 104/521 (20%)
4-S 28..436 CDD:293753 99/481 (21%)
Sulf2NP_001030099.1 G6S 43..385 CDD:293766 89/396 (22%)
DUF3740 533..666 CDD:403667
ALP_like <754..803 CDD:419962
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351089
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.