DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7402 and Arsj

DIOPT Version :9

Sequence 1:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_001041352.1 Gene:Arsj / 311013 RGDID:1307640 Length:597 Species:Rattus norvegicus


Alignment Length:541 Identity:198/541 - (36%)
Similarity:284/541 - (52%) Gaps:57/541 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GSGYSTKPNIVIILIDDMGMNDVSFHGSNQILTPNIDALAYNGILLNKHYVPNLCTPSRATLLTG 85
            |:..:::|:::.||.||.|..||.:||| :|.||.:|.||..|:.|..:||..:|||||:..:||
  Rat    67 GTAVTSQPHLIFILADDQGFRDVGYHGS-EIKTPTLDKLAAEGVKLENYYVQPICTPSRSQFITG 130

  Fly    86 KYPIHTGMQHFVIITDEPWGLPQRERLMPEIFRDAGYSTHLVGKWHLGFWRKDLTPTMRGFDHHF 150
            ||.||||:||.:|...:|..||.....:|:..::.|||||:||||||||:|||..||.||||..|
  Rat   131 KYQIHTGLQHSIIRPTQPNCLPLDNATLPQKLKEVGYSTHMVGKWHLGFYRKDCMPTKRGFDTFF 195

  Fly   151 GYYNGYIDYYDHQVRMLDRNYSAGLD-FRRDLEPCPEANGTYATEAFTSEAKRIIEQHDKSKPLF 214
            |...|..|||.|.  ..|.....|.| :..|.......||.|:|:.:|...::|:..||.:||||
  Rat   196 GSLLGSGDYYTHY--KCDSPGVCGYDLYENDNAAWDYDNGIYSTQMYTQRVQQILASHDPTKPLF 258

  Fly   215 MVLSHLAVHTGNEDSPMQAPEEEVAKFPHIRDPKRRTYAGMISSLDKSVAQTIGALKDNGMLNNS 279
            :.:::.|||     ||:|||......:..|.:..||.||.|:|.||:::.....|||..|..|||
  Rat   259 LYVAYQAVH-----SPLQAPGRYFEHYRSIININRRRYAAMLSCLDEAIHNVTLALKRYGFYNNS 318

  Fly   280 IILLYSDNGA-PTIGIHSNAGSNYPYRGQKESPWEGGIRSAGALWSPLLKERGYVSNQAIHAVDW 343
            ||:..||||. ||.|     |||:|.||.|.:.||||||:.|.:.|||||.:|.|..:.:|..||
  Rat   319 IIIYSSDNGGQPTAG-----GSNWPLRGSKGTYWEGGIRAVGFVHSPLLKNKGTVCKELVHITDW 378

  Fly   344 LPTLAGAAGVSLPQDLPLDGINLWPMLS-GNEEPKPRTMIHVLDEVFGYSSYMRDTLKYVNGSSF 407
            .|||...|...:.:|:.|||.::|..:| |...|:. .::|.:|.::         .|..|||..
  Rat   379 YPTLISLAEGQIDEDIQLDGYDIWETISEGLRSPRV-DILHNIDPIY---------TKAKNGSWA 433

  Fly   408 KGRYDQWLGELETNEDDPLGESYEQHVLASDVQSLLGNRGLTKDRIRQMRSEATETCPPIEGQNP 472
            .| |..|            ..:.:..:.....:.|.||.|.            ::..||....|.
  Rat   434 AG-YGIW------------NTAIQSAIRVQHWKLLTGNPGY------------SDWVPPQAFSNL 473

  Fly   473 LESHFKCEPL-----KAPCFFDLAKDPCERYNLAQMYPLQLQQLADELEQIRKTAIPSARVPHSD 532
            ..:.:..|.:     |:...|::..||.||.:|:..||..:::|...|.|..|||:| .|.|..|
  Rat   474 GPNRWHNERITLSTGKSIWLFNITADPYERVDLSSRYPGIVKKLLRRLSQFNKTAVP-VRYPPKD 537

  Fly   533 SRANPTFHNGNWEWWNNTDTQ 553
            .|:||..:.|.|..|...:::
  Rat   538 PRSNPRLNGGVWGPWYKEESK 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 168/436 (39%)
4-S 28..436 CDD:293753 164/410 (40%)
ArsjNP_001041352.1 AslA 71..507 CDD:225661 178/483 (37%)
4-S 74..507 CDD:293753 178/480 (37%)
DUF4976 <493..>531 CDD:303608 15/38 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D375140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.