DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7402 and Arsg

DIOPT Version :9

Sequence 1:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_001041342.1 Gene:Arsg / 303631 RGDID:1306571 Length:526 Species:Rattus norvegicus


Alignment Length:563 Identity:143/563 - (25%)
Similarity:223/563 - (39%) Gaps:134/563 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVLLVVSSIL------SLAYGSGYSTKPNIVIILIDDMGMNDVSFHGSNQILTPNIDALAYNGI 64
            :||.:|.|.:|      |:: |...:.:|||||||.||||..|:..:.:....|.|:|.:|..|:
  Rat     9 LLVGMVFSGLLYPFVDFSIS-GETRAPRPNIVIILADDMGWGDLGANWAETKDTTNLDKMASEGM 72

  Fly    65 -LLNKHYVPNLCTPSRATLLTGKYPIHTGMQHFVIITDEPWGLPQRERLMPEIFRDAGYSTHLVG 128
             .::.|...:.|:||||:||||:..:..|:.|...:| ...|||..|..:.|:.:.|||.|.::|
  Rat    73 RFVDFHAAASTCSPSRASLLTGRLGLRNGVTHNFAVT-SVGGLPLNETTLAEVLQQAGYVTAMIG 136

  Fly   129 KWHLGFWRKDLTPTMRGFDHHFG--YYN--------GYIDYYDHQVRMLDRNYSAGLDFRRDLEP 183
            |||||. .....|:.||||::||  |.|        ||             ||.       ....
  Rat   137 KWHLGH-HGSYHPSFRGFDYYFGIPYSNDMGCTDNPGY-------------NYP-------PCPA 180

  Fly   184 CPEANGTY------------------------------ATEAFTSEAKRIIEQHDKS-KP--LFM 215
            ||:::|.:                              ..:.:...|...|||...| :|  |::
  Rat   181 CPQSDGRWRNPDRDCYTDVALPLYENLNIVEQPVNLSGLAQKYAERAVEFIEQASTSGRPFLLYV 245

  Fly   216 VLSHLAVHTGNEDSPMQAPEEEVAKFPHIRDPK-RRTYAGMISSLDKSVAQTIGALKDNGMLNNS 279
            .|:|:.|       |:...       |.:.:|: :|.|...:..:|..|.| |....|:....|:
  Rat   246 GLAHMHV-------PLSVT-------PPLANPQSQRLYRASLQEMDSLVGQ-IKDKVDHVAKENT 295

  Fly   280 IILLYSDNGAPTIGIHSNAGSNYPYRG----------QKESPWEGGIRSAGALWSPLLKERGYVS 334
            ::....||| |.......|||..|:.|          .|::.||||.|.....:.|........|
  Rat   296 LLWFAGDNG-PWAQKCELAGSMGPFSGLWQTHQGGSPAKQTTWEGGHRVPALAYWPGRVPVNVTS 359

  Fly   335 NQAIHAVDWLPTLAGAAGVSLPQDLPLDGINLWPMLSGNEEPKPRTMIH----VLDEVFGYSSYM 395
            ...:..:|..||:...||.|||.:...||:::..:|.|..:...|.:.|    ...|.....:..
  Rat   360 TALLSLLDIFPTVIALAGASLPPNRKFDGVDVSEVLFGKSQTGHRVLFHPNSGAAGEYGALQTVR 424

  Fly   396 RDTLK--YVNGSSFK-----GRYDQWLGELETNEDDPLGES---------YEQ------HVLASD 438
            .|..|  |:.|.:..     |.....:..|..|.:|...||         |::      .|||..
  Rat   425 LDRYKAFYITGGAKACDGGVGPEQHHVSPLIFNLEDDAAESSPLQKGSPEYQELLPKVTRVLADV 489

  Fly   439 VQSLLGNRGLTKDRIRQMRSEATETCPPIEGQNPLESHFKCEP 481
            :|.:..:.....|..:.  ...|..|      ||.:...:|:|
  Rat   490 LQDIADDNSSQADYTQD--PSVTPCC------NPYQITCRCQP 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 130/514 (25%)
4-S 28..436 CDD:293753 126/488 (26%)
ArsgNP_001041342.1 ARSG 35..469 CDD:293780 124/471 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351142
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.