DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7402 and GNS

DIOPT Version :9

Sequence 1:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:NP_002067.1 Gene:GNS / 2799 HGNCID:4422 Length:552 Species:Homo sapiens


Alignment Length:593 Identity:133/593 - (22%)
Similarity:209/593 - (35%) Gaps:167/593 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVLLVVSSILSLAYGSGYSTKPNIVIILIDDMGMNDVSFHGSNQILTP--NIDAL-AYNGILLNK 68
            |:|||:...|.:...:..:.:||:|::|.||   .|....|    :||  ...|| ...|:..:.
Human    26 LLLLVLGGCLGVFGVAAGTRRPNVVLLLTDD---QDEVLGG----MTPLKKTKALIGEMGMTFSS 83

  Fly    69 HYVPN-LCTPSRATLLTGKYPIHTGMQHFVI-------ITDEPWGLPQRERLMPEIFRD-AGYST 124
            .|||: ||.||||::|||||| |   .|.|:       .:.:.|...|.....|.|.|. .||.|
Human    84 AYVPSALCCPSRASILTGKYP-H---NHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQT 144

  Fly   125 HLVGKW--HLGFWRKDLTPTMRGFDH-------------HFGYYNGYIDYYDHQVRMLDRNYSAG 174
            ...||:  ..|      .|...|.:|             :..||| |....:.:.|....|||. 
Human   145 FFAGKYLNEYG------APDAGGLEHVPLGWSYWYALEKNSKYYN-YTLSINGKARKHGENYSV- 201

  Fly   175 LDFRRDLEPCPEANGTYATEAFTSEAKRIIEQHDKSKPLFMVLSHLAVHTGNEDSPMQAPEEEVA 239
                           .|.|:...:.:...::.....:|.||:::..|.|     ||..|..:...
Human   202 ---------------DYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPH-----SPWTAAPQYQK 246

  Fly   240 KFPHIRDPKRRTYA---------------------------------GMISSLDKSVAQTIGALK 271
            .|.::..|:.:.:.                                 ..:.|:|..|.:.:..|:
Human   247 AFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVDDLVEKLVKRLE 311

  Fly   272 DNGMLNNSIILLYSDNGAPTIGIHSNAGSNYPYRGQ------KESPWEGGIRSAGALWSPLLKER 330
            ..|.|||:.|...||||..|              ||      |...:|..|:....:..|.:|. 
Human   312 FTGELNNTYIFYTSDNGYHT--------------GQFSLPIDKRQLYEFDIKVPLLVRGPGIKP- 361

  Fly   331 GYVSNQAIHAVDWLPTLAGAAGVSLPQDLPLDGINLWPMLSGNEEPKPRTMIHVLDEVFGYSSYM 395
            ...|...:..:|..||:...||..| ....:||::|.|:|.|...                .::.
Human   362 NQTSKMLVANIDLGPTILDIAGYDL-NKTQMDGMSLLPILRGASN----------------LTWR 409

  Fly   396 RDTLKYVNGSSFKGRYDQWLGELETNEDDPLGESYEQHVLASDVQSLLGNRGLTKDRIRQMRSEA 460
            .|.|....|   :||          |..||...|     |:..|....      .|.:.:.....
Human   410 SDVLVEYQG---EGR----------NVTDPTCPS-----LSPGVSQCF------PDCVCEDAYNN 450

  Fly   461 TETCPPIEGQNPLESHFKCEPLKAPCF---FDLAKDPCERYNLAQ-MYPLQLQQLADELEQIRKT 521
            |..|  :...:.|.:...||......|   ::|..||.:..|:|: :.|..|.::...|..::..
Human   451 TYAC--VRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSC 513

  Fly   522 AIPSARVP 529
            :.|:.|.|
Human   514 SGPTCRTP 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 111/499 (22%)
4-S 28..436 CDD:293753 108/473 (23%)
GNSNP_002067.1 G6S 46..495 CDD:293766 122/545 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157142
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.