DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7402 and Sulf1

DIOPT Version :9

Sequence 1:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:XP_008761708.1 Gene:Sulf1 / 171396 RGDID:708554 Length:1117 Species:Rattus norvegicus


Alignment Length:552 Identity:122/552 - (22%)
Similarity:202/552 - (36%) Gaps:164/552 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KPNIVIILIDDMGMNDVSFHGSNQILTPNIDALAYNGILLNKHYVPN-LCTPSRATLLTGKYPIH 90
            :|||:::|.||   .||.. ||.|::......:.:.|......:|.. :|.|||:::||||| :|
  Rat    42 RPNIILVLTDD---QDVEL-GSLQVMNKTRKIMEHGGATFTNAFVTTPMCCPSRSSMLTGKY-VH 101

  Fly    91 TGMQHFVIITDEPWGLPQRERL-MPEIF----RDAGYSTHLVGKWHLGFWRKDLTPTMRGFDHHF 150
               .|.|...:|....|..:.| .|..|    .:.||.|...||                   :.
  Rat   102 ---NHNVYTNNENCSSPSWQALHEPRTFAVYLNNTGYRTAFFGK-------------------YL 144

  Fly   151 GYYNG-YID--------------YYDHQVRMLDRNYSAGLDFRRDLEPCPEANGTYATEAFTSEA 200
            ..||| ||.              :|::.|.........|.|:.:|          |.|:..|:|:
  Rat   145 NEYNGSYIPPGWREWLGLIKNSRFYNYTVCRNGIKEKHGFDYAKD----------YFTDLITNES 199

  Fly   201 KRIIEQHDK---SKPLFMVLSHLAVHTGNEDSPMQ------------------APEEEV------ 238
            ....:...:   .:|:.||:||.|.| |.|||..|                  ||..:.      
  Rat   200 INYFKMSKRMYPHRPVMMVISHAAPH-GPEDSAPQFSKLYPNASQHITPSYNYAPNMDKHWIMQY 263

  Fly   239 --------AKFPHIRDPKRRTYAGMISSLDKSVAQTIGALKDNGMLNNSIILLYSDNGAPTIGIH 295
                    .:|.::...||   ...:.|:|.||.:....|.:.|.|.|:.|:..:|:|.      
  Rat   264 TGPMLPIHMEFTNVLQRKR---LQTLMSVDDSVERLYNMLVETGELGNTYIIYTADHGY------ 319

  Fly   296 SNAGSNYPYRGQ------KESPWEGGIRSAGALWSPLLKERGYVSNQAIHAVDWLPTLAGAAGVS 354
                    :.||      |..|::..||....:..|.: |.|.:..|.:..:|..||:...||:.
  Rat   320 --------HIGQFGLVKGKSMPYDFDIRVPFFIRGPSI-EPGSIVPQIVLNIDLAPTILDIAGLD 375

  Fly   355 LPQDLPLDGINLWPMLSGNEEPKPRTMIHVLDEVFGYSSYMRDTLKYVNGSSFKGRYDQWLGELE 419
            .|.|  :||.::..:|. .|:|..|...:...:::      |||.....|...:.:.:.      
  Rat   376 TPSD--VDGKSVLKLLD-LEKPGNRFRTNKKAKIW------RDTFLVERGKFLRKKEES------ 425

  Fly   420 TNEDDPLGESYEQHVLASDVQSLLGNRGLTK-DRIRQMRSEAT-ETCPPIEGQNPLESHFKC-EP 481
                            :.::|.   :..|.| :|::::..:|. :|.....|||     ::| |.
  Rat   426 ----------------SKNIQQ---SNHLPKYERVKELCQQARYQTACEQPGQN-----WQCIED 466

  Fly   482 LKAPCFFDLAKDPCE----RYNLAQMYPLQLQ 509
            ..........|.|.:    |.|...:|...||
  Rat   467 TSGKLRIHKCKGPSDLLTVRQNARNLYSRGLQ 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 108/494 (22%)
4-S 28..436 CDD:293753 104/469 (22%)
Sulf1XP_008761708.1 G6S 42..384 CDD:293766 96/399 (24%)
DUF3740 534..675 CDD:403667
ALP_like <767..816 CDD:419962
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351095
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.