DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7402 and arsa.1

DIOPT Version :9

Sequence 1:NP_649023.1 Gene:CG7402 / 39994 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster
Sequence 2:XP_002938337.3 Gene:arsa.1 / 100486429 XenbaseID:XB-GENE-5959463 Length:507 Species:Xenopus tropicalis


Alignment Length:569 Identity:157/569 - (27%)
Similarity:226/569 - (39%) Gaps:147/569 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILSLAYGSGYSTKPNIVIILIDDMGMNDVSFHGSNQILTPNIDALAYNGILLNKHY-VPNLCTPS 78
            :|...|....:..|||::||.||:|..|:..:|....||||:|.:|..|:.....| ...:|:||
 Frog     8 LLGYMYTMVIADSPNIILILADDLGYGDLGCYGHPSSLTPNLDQMAARGLRFRDFYSTGTVCSPS 72

  Fly    79 RATLLTGKYPIHTGMQHFVIITDEPWGLPQRERLMPEIFRDAGYSTHLVGKWHLGF-WRKDLTPT 142
            ||:|:||:|....|:...|.......|||..|..:.|:.:.:||.|.:|||||||. ......||
 Frog    73 RASLMTGRYQSRNGVYPGVFYPGSRGGLPLSEVTIAEMLQSSGYITAMVGKWHLGLGLNGTYLPT 137

  Fly   143 MRGFDHHFGYYNGYIDYYDHQVRMLDRNYSAGLDFRRDLEPC------PEANGTYAT----EA-- 195
            .:||.|..                       |:.|..|..||      |.....|.|    ||  
 Frog   138 RQGFQHFL-----------------------GVPFSHDQGPCQNLTCFPPNISCYGTCDLGEALL 179

  Fly   196 --FTSEAKRIIEQ-----------------------HDKSKPLFM-VLSHLAVHTGNEDSPMQAP 234
              |..|  :||:|                       .|| ||.|: ..||   ||       ..|
 Frog   180 PLFLGE--KIIQQPVDFTKLVPKYQKFSKSFISAAVKDK-KPFFLYYASH---HT-------HYP 231

  Fly   235 EEEVAKFPHIRDPKRRTYAGMISSLDKSVAQTIGALKDNGMLNNSIILLYSDNGAPTIGIHSNAG 299
              :.|...:.....|..:...:..||.||.:.:.|:.:||:.||::|:..||||..|:.:.....
 Frog   232 --QFASAQYTGQSLRGRFGDALLELDGSVGELLRAIWENGIQNNTLIIFTSDNGPETMRMERGGC 294

  Fly   300 SNYPYRGQKESPWEGGIRSAGAL-WSPLLKERGYVSNQAIHAVDWLPTLAGAAGVSLPQDLPLDG 363
            |.....| |.:.:|||:|....: |...::..  |:::....:|.|||||...|.|||..: |||
 Frog   295 SGLLKCG-KSTTYEGGVREPAIMYWEGNIQPG--VTSELASTLDILPTLASLTGASLPTTV-LDG 355

  Fly   364 INLWPMLSGNEEPKPRTMIHVLDEVFGYSSYMRDTLKYVNGSSFKGRYDQWLGELETNEDDPLGE 428
            .:|..:|. |..|.||...|.      |.||:...         ||.:...||:           
 Frog   356 YDLSKLLF-NGHPSPRNTFHY------YPSYLEPK---------KGIFALRLGK----------- 393

  Fly   429 SYEQHVLASDVQSLLGNRGLTKDRIRQMRSEATETCPPIEGQNPLESHFKCEPLKAPCFFDLAKD 493
             |:.|......                ..||.|.. |.......|:.|   :|   |..|||:.|
 Frog   394 -YKAHFYTEGA----------------FHSETTPD-PDCHVTALLKYH---DP---PLLFDLSND 434

  Fly   494 PCERYNL------AQMYPLQLQQLADELEQIRKTAIPSARVPHSDSRAN 536
            |.|.|||      ..:.|: |:::..|.::..||      |.::||..|
 Frog   435 PAENYNLLKDGIPVDLVPV-LKEILAEQKRFEKT------VKYADSEIN 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 129/474 (27%)
4-S 28..436 CDD:293753 129/448 (29%)
arsa.1XP_002938337.3 ARSA 20..501 CDD:293777 155/557 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.