DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16775 and CNI1

DIOPT Version :9

Sequence 1:NP_649022.2 Gene:CG16775 / 39993 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_198094.1 Gene:CNI1 / 832801 AraportID:AT5G27420 Length:368 Species:Arabidopsis thaliana


Alignment Length:147 Identity:32/147 - (21%)
Similarity:45/147 - (30%) Gaps:61/147 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SSAIVAVVLVQMVAQIHGGVYSYEDKWVYLDKTLDLPEEAILGGVDPDGYYTYVGRVTYSSNILP 70
            |.|:..||:|.:.|....|.::     ||:        ....|.||        |.||      |
plant    42 SPAMAVVVVVVIAALFFMGFFT-----VYI--------RHCTGAVD--------GSVT------P 79

  Fly    71 ARVVPELGKATYNTDTLGNQATTYEVLVSNATVGYHWIRSFDG----------FREKNAVSVGTN 125
            |      |.|...              |:||||.    |..|.          :.|.....:|..
plant    80 A------GGARRR--------------VTNATVA----RGLDAETIETFPTFVYSEVKTQKIGKG 120

  Fly   126 ALSERVFICRVRCDESI 142
            ||...:.:.....||::
plant   121 ALECAICLNEFEDDETL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16775NP_649022.2 DM9 29..100 CDD:128937 13/70 (19%)
DUF3421 51..164 CDD:288732 21/102 (21%)
DM9 104..175 CDD:128937 8/49 (16%)
CNI1NP_198094.1 RING-H2_EL5_like 123..166 CDD:319375 2/15 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.