DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16775 and AgaP_AGAP009605

DIOPT Version :9

Sequence 1:NP_649022.2 Gene:CG16775 / 39993 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_001238018.1 Gene:AgaP_AGAP009605 / 4578182 VectorBaseID:AGAP009605 Length:181 Species:Anopheles gambiae


Alignment Length:152 Identity:35/152 - (23%)
Similarity:57/152 - (37%) Gaps:29/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QIHGGVYSYEDKWVYLDKTLDLPEEAILGGVDPDGYYTYVGRVTYSSNILPARV--------VPE 76
            |:|.....:..|||....:..||..|:..|.. .....|:||..::.::.|..:        :|.
Mosquito    30 QLHRWDALHSMKWVPYQDSGPLPPSAVECGTS-KRTKLYLGRAEHAGSVTPGFINPAKKVCYIPW 93

  Fly    77 LGKATYNTDTLGNQATTYEVLVSNATVGYHWIRSFDGFREKN----AVSVGTNALSERVFICRVR 137
            .|||        ::....|:|   .|.|     .|....|.|    |...|.:...|.::|.||.
Mosquito    94 GGKA--------HEKKVCEIL---CTAG-----EFVPCTETNVLLRATPAGVSEQGEPLYIGRVA 142

  Fly   138 CDESIFIGTLYLSKRMCIVKYD 159
            .|..:..|.:..|..:|.:.|:
Mosquito   143 VDGQLVCGKVQRSHSVCYIPYN 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16775NP_649022.2 DM9 29..100 CDD:128937 17/78 (22%)
DUF3421 51..164 CDD:288732 26/121 (21%)
DM9 104..175 CDD:128937 15/60 (25%)
AgaP_AGAP009605XP_001238018.1 DM9 40..107 CDD:128937 17/78 (22%)
DUF3421 66..167 CDD:288732 26/115 (23%)
DM9 113..175 CDD:128937 13/52 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.