DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16775 and CG5506

DIOPT Version :9

Sequence 1:NP_649022.2 Gene:CG16775 / 39993 FlyBaseID:FBgn0036767 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_649021.1 Gene:CG5506 / 39992 FlyBaseID:FBgn0036766 Length:180 Species:Drosophila melanogaster


Alignment Length:169 Identity:82/169 - (48%)
Similarity:112/169 - (66%) Gaps:2/169 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVAVVLVQM-VAQIHGGVYSYEDKWVYLDKTLDLPEEAILGGVDPDGYYTYVGRVTYSSNILPAR 72
            :|.|||... ||......|..|..|...:.:..:|..|::||.||.|:.||||||.||::|||||
  Fly     4 LVCVVLALFAVAYAVPSTYDTEHVWKAGNLSYVIPYNAVVGGFDPYGFTTYVGRVKYSNSILPAR 68

  Fly    73 VVPELGKATYNTDTLGNQATTYEVLVSNATVGYHWIRSFDGFREKNAVSVGTNALSERVFICRVR 137
            ||.|.|.|.:||:|..::...|::||:...|.|.|:||||||.||.||:|||...:||||.||.:
  Fly    69 VVAETGTAYFNTETTSSKLLVYDILVAERDVNYVWVRSFDGFYEKGAVAVGTTVKNERVFCCRAK 133

  Fly   138 CDESIFIGTLYL-SKRMCIVKYDNFPLRQFDKYEILVRE 175
            .|..|.||||.| |:::||:|:::..||:|||||:||.:
  Fly   134 TDGGILIGTLLLSSQKVCIIKHESLALRKFDKYEVLVAQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16775NP_649022.2 DM9 29..100 CDD:128937 33/70 (47%)
DUF3421 51..164 CDD:288732 60/113 (53%)
DM9 104..175 CDD:128937 41/71 (58%)
CG5506NP_649021.1 DM9 25..96 CDD:128937 33/70 (47%)
DUF3421 47..161 CDD:288732 60/113 (53%)
DM9 100..172 CDD:128937 41/71 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449314
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005929
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR31649
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.